Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04120 100 / 7e-27 GAPC1, GAPC-1, GAPC glyceraldehyde-3-phosphate dehydrogenase C subunit 1 (.1) AT1G13440 98 / 3e-26 GAPC2, GAPC-2 GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE C-2, glyceraldehyde-3-phosphate dehydrogenase C2 (.1.2) AT1G79530 92 / 2e-23 GAPCP-1 glyceraldehyde-3-phosphate dehydrogenase of plastid 1 (.1) AT1G16300 88 / 4e-22 GAPCP-2 glyceraldehyde-3-phosphate dehydrogenase of plastid 2 (.1) AT1G42970 50 / 2e-08 GAPB glyceraldehyde-3-phosphate dehydrogenase B subunit (.1) AT3G26650 39 / 0.0002 GAPA-1, GAPA GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE A SUBUNIT 1, glyceraldehyde 3-phosphate dehydrogenase A subunit (.1) AT1G12900 38 / 0.0002 GAPA-2 glyceraldehyde 3-phosphate dehydrogenase A subunit 2 (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015826 [exp] 112 / 2e-31 AT3G04120 606 / 0.0 glyceraldehyde-3-phosphate dehydrogenase C subunit 1 (.1) Lus10036976 [exp] 112 / 4e-31 AT3G04120 592 / 0.0 glyceraldehyde-3-phosphate dehydrogenase C subunit 1 (.1) Lus10006435 [exp] 106 / 2e-29 AT3G04120 593 / 0.0 glyceraldehyde-3-phosphate dehydrogenase C subunit 1 (.1) Lus10011375 [exp] 106 / 2e-29 AT3G04120 593 / 0.0 glyceraldehyde-3-phosphate dehydrogenase C subunit 1 (.1) Lus10000872 [exp] 91 / 5e-23 AT1G16300 694 / 0.0 glyceraldehyde-3-phosphate dehydrogenase of plastid 2 (.1) Lus10009602 [exp] 91 / 7e-23 AT1G16300 694 / 0.0 glyceraldehyde-3-phosphate dehydrogenase of plastid 2 (.1) Lus10022332 [exp] 90 / 7e-23 AT1G13440 632 / 0.0 GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE C-2, glyceraldehyde-3-phosphate dehydrogenase C2 (.1.2) Lus10014603 [exp] 89 / 2e-22 AT3G04120 634 / 0.0 glyceraldehyde-3-phosphate dehydrogenase C subunit 1 (.1) Lus10032071 [exp] 89 / 2e-22 AT3G04120 634 / 0.0 glyceraldehyde-3-phosphate dehydrogenase C subunit 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G094100 [exp] 100 / 4e-27 AT1G13440 580 / 0.0 GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE C-2, glyceraldehyde-3-phosphate dehydrogenase C2 (.1.2) Potri.015G091400 [exp] 98 / 4e-26 AT1G13440 578 / 0.0 GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE C-2, glyceraldehyde-3-phosphate dehydrogenase C2 (.1.2) Potri.010G055400 [exp] 96 / 3e-25 AT3G04120 592 / 0.0 glyceraldehyde-3-phosphate dehydrogenase C subunit 1 (.1) Potri.008G179300 [exp] 94 / 1e-24 AT3G04120 573 / 0.0 glyceraldehyde-3-phosphate dehydrogenase C subunit 1 (.1) Potri.001G335800 [exp] 91 / 1e-23 AT3G04120 585 / 0.0 glyceraldehyde-3-phosphate dehydrogenase C subunit 1 (.1) Potri.010G172400 [exp] 91 / 5e-23 AT1G16300 618 / 0.0 glyceraldehyde-3-phosphate dehydrogenase of plastid 2 (.1) Potri.008G083900 [exp] 86 / 2e-21 AT1G16300 634 / 0.0 glyceraldehyde-3-phosphate dehydrogenase of plastid 2 (.1) Potri.014G140500 [exp] 39 / 9e-05 AT3G26650 622 / 0.0 GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE A SUBUNIT 1, glyceraldehyde 3-phosphate dehydrogenase A subunit (.1) Potri.002G007100 [exp] 39 / 0.0001 AT1G42970 690 / 0.0 glyceraldehyde-3-phosphate dehydrogenase B subunit (.1) Potri.005G254100 [exp] 37 / 0.0004 AT1G42970 732 / 0.0 glyceraldehyde-3-phosphate dehydrogenase B subunit (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0139 [flax] [poplar] GADPH_aa-bio_dh PF02800 [flax] [poplar] Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10033306 pacid=23172072 polypeptide=Lus10033306 locus=Lus10033306.g ID=Lus10033306.BGIv1.0 annot-version=v1.0 ATGAGTCCTTTCCGTTTACAGGTTCTCCCAGTACTCAGCGGCAAGTTGACTGGAATGTCTTTCCGTCTCTTAACTGCTGATGTCTCAGTTGTTGACTTGA CCGTCAAGCTTGAGAAGGCTGCCATCAAGGAGAAGTCTGAGGGTAAGCTCAAGGGTACTCTTGGATACGTTGATGAGGATGTTGTCTCTGCTGATTTCCT CGGTGACAACAGGTCAATTGCATCTTCGATGCCAAGGCTGGAATTGCATTGA
AA sequence Show only first row Show all	>Lus10033306 pacid=23172072 polypeptide=Lus10033306 locus=Lus10033306.g ID=Lus10033306.BGIv1.0 annot-version=v1.0 MSPFRLQVLPVLSGKLTGMSFRLLTADVSVVDLTVKLEKAAIKEKSEGKLKGTLGYVDEDVVSADFLGDNRSIASSMPRLELH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04120		GAPC1, GAPC-1, ...	glyceraldehyde-3-phosphate deh...		Lus10033306 [exp]	0	1
AT1G17930			Aminotransferase-like, plant m...		Lus10001981 [exp]	3.0	1.0000
AT4G13420		HAK5, ATHAK5	high affinity K+ transporter 5...		Lus10005194 [exp]	4.5	1.0000
					Lus10027667 [exp]	5.2	1.0000
AT4G34540			NmrA-like negative transcripti...		Lus10012146 [exp]	5.5	1.0000
					Lus10015682 [exp]	6.0	1.0000
AT4G18340			Glycosyl hydrolase superfamily...		Lus10031034 [exp]	6.7	1.0000
AT2G25940		ALPHAVPE, ALPHA...	alpha-vacuolar processing enzy...		Lus10033344 [exp]	6.9	1.0000
					Lus10032314 [exp]	7.5	0.9354
AT2G14378			Protein of unknown function (D...		Lus10019101 [exp]	7.7	1.0000
AT3G20800			Cell differentiation, Rcd1-lik...		Lus10015136 [exp]	8.1	0.8506

Compare expression of checked genes

Lus10033306 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.