Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G19350 39 / 6e-05 EMB3006 embryo defective 3006 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G235300 [exp] 66 / 1e-14 AT4G19350 159 / 9e-50 embryo defective 3006 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033307 pacid=23172200 polypeptide=Lus10033307 locus=Lus10033307.g ID=Lus10033307.BGIv1.0 annot-version=v1.0 ATGGAGGTAGGAGAAGCAGGGCGGCGGAACGGAGGCGGTTCAAGTTCGAGGGAGTCAGATCTCAACAAGTCTTTCAATCTTGCCATTCGTTCTCTCCTCA CCGGTTGCTCTGATGAGGAATTTCAGAAAGCGTTCTCGAAGTTCAGCCGTAAAGAACAGTTAGGGATCCACAGATTGTACATTCAGGTTAAGTTCTTCCA TCTCCTTCAAACTGACAGTGTTGCGTGGAGGATTAGTAGCTTAGATTCTCTTAGAGCTTGA
AA sequence Show only first row Show all	>Lus10033307 pacid=23172200 polypeptide=Lus10033307 locus=Lus10033307.g ID=Lus10033307.BGIv1.0 annot-version=v1.0 MEVGEAGRRNGGGSSSRESDLNKSFNLAIRSLLTGCSDEEFQKAFSKFSRKEQLGIHRLYIQVKFFHLLQTDSVAWRISSLDSLRA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G19350		EMB3006	embryo defective 3006 (.1)		Lus10033307 [exp]	0	1
AT5G49950			alpha/beta-Hydrolases superfam...		Lus10037322 [exp]	9.4	0.9136
AT1G65900			unknown protein		Lus10007381 [exp]	17.9	0.9035
AT2G14820		MEL3, NPY2	NAKED PINS IN YUC MUTANTS 2, M...		Lus10033796 [exp]	17.9	0.9034
AT3G29320		PHS1	alpha-glucan phosphorylase 1, ...		Lus10042688 [exp]	25.6	0.8977
AT3G43590			zinc knuckle (CCHC-type) famil...		Lus10029311 [exp]	28.6	0.8261
AT5G40830		ATRAD3, ATATR	S-adenosyl-L-methionine-depend...		Lus10020803 [exp]	31.7	0.9009
AT1G58370		ATXYN1, RXF12	ARABIDOPSIS THALIANA XYLANASE ...		Lus10028242 [exp]	32.7	0.9001
AT5G40830		ATRAD3, ATATR	S-adenosyl-L-methionine-depend...		Lus10007385 [exp]	36.6	0.8986
AT3G61920			unknown protein		Lus10023060 [exp]	41.5	0.8979
AT2G13290			beta-1,4-N-acetylglucosaminylt...		Lus10019400 [exp]	43.6	0.8982

Compare expression of checked genes

Lus10033307 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.