Lus10033312 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G35605 68 / 6e-16 SWIB/MDM2 domain superfamily protein (.1)
AT1G31760 65 / 7e-15 SWIB/MDM2 domain superfamily protein (.1)
AT3G03590 63 / 8e-14 SWIB/MDM2 domain superfamily protein (.1)
AT4G34290 58 / 8e-12 SWIB/MDM2 domain superfamily protein (.1)
AT2G14880 54 / 4e-10 SWIB/MDM2 domain superfamily protein (.1)
AT1G17510 50 / 4e-09 unknown protein
AT4G26810 40 / 2e-05 SWIB/MDM2 domain superfamily protein (.1.2)
AT3G19080 39 / 0.0003 SWIB complex BAF60b domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034774 221 / 1e-76 AT2G35605 68 / 6e-16 SWIB/MDM2 domain superfamily protein (.1)
Lus10005667 65 / 2e-14 AT3G03590 118 / 4e-35 SWIB/MDM2 domain superfamily protein (.1)
Lus10013893 57 / 2e-11 AT2G14880 143 / 7e-45 SWIB/MDM2 domain superfamily protein (.1)
Lus10002106 55 / 3e-11 AT4G34290 109 / 2e-32 SWIB/MDM2 domain superfamily protein (.1)
Lus10019640 45 / 1e-06 AT3G19080 256 / 2e-81 SWIB complex BAF60b domain-containing protein (.1)
Lus10009333 44 / 7e-06 AT3G19080 266 / 4e-87 SWIB complex BAF60b domain-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G078400 149 / 8e-48 AT2G35605 66 / 6e-15 SWIB/MDM2 domain superfamily protein (.1)
Potri.013G070600 63 / 1e-13 AT2G35605 108 / 2e-31 SWIB/MDM2 domain superfamily protein (.1)
Potri.009G092200 61 / 7e-13 AT2G14880 169 / 7e-55 SWIB/MDM2 domain superfamily protein (.1)
Potri.001G297400 59 / 3e-12 AT2G14880 142 / 3e-44 SWIB/MDM2 domain superfamily protein (.1)
Potri.005G134500 44 / 4e-06 AT3G19080 226 / 3e-70 SWIB complex BAF60b domain-containing protein (.1)
Potri.015G137600 37 / 0.0006 AT4G26810 181 / 1e-60 SWIB/MDM2 domain superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02201 SWIB SWIB/MDM2 domain
Representative CDS sequence
>Lus10033312 pacid=23172171 polypeptide=Lus10033312 locus=Lus10033312.g ID=Lus10033312.BGIv1.0 annot-version=v1.0
ATGGCGGTAGGAAACACCAGAATGTTGCTGAAGAAGGCGTTGATCCGCCACCCTGCCTACGCATCCAAAGGAAGCATCGTCAATTCCCAGATCAAAGCCA
AGGTCATCCCACCCTCTTCTTCTCAGTTGGGGAAGTTCCTCGGGATTCCTGAACCCGCTCGCTCCGATCTTACCAAGCTCATCTCCCGCTTCATTAAGCT
CAACAATCGCCAGAATCCCGGAATGAAGAAAGATCATCTCACTGAAGACAAGCTGAAATCTTTGCTGGCTGGGAAGGAAAGAATTGGTATCCCTGAGATA
GCCAAGTTGCTTTCCCAACAATTTGTCAAATCTTGA
AA sequence
>Lus10033312 pacid=23172171 polypeptide=Lus10033312 locus=Lus10033312.g ID=Lus10033312.BGIv1.0 annot-version=v1.0
MAVGNTRMLLKKALIRHPAYASKGSIVNSQIKAKVIPPSSSQLGKFLGIPEPARSDLTKLISRFIKLNNRQNPGMKKDHLTEDKLKSLLAGKERIGIPEI
AKLLSQQFVKS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G35605 SWIB/MDM2 domain superfamily p... Lus10033312 0 1
AT3G12390 Nascent polypeptide-associated... Lus10026133 3.7 0.7877
AT3G07640 unknown protein Lus10041098 4.7 0.7628
AT2G35605 SWIB/MDM2 domain superfamily p... Lus10034774 7.1 0.7124
AT5G20180 Ribosomal protein L36 (.1.2) Lus10019412 7.1 0.7622
AT3G26360 Ribosomal protein S21 family p... Lus10006466 7.9 0.7271
AT3G06050 PRXIIF, ATPRXII... peroxiredoxin IIF (.1) Lus10021932 9.4 0.7216
AT1G55205 unknown protein Lus10023655 11.0 0.7318
AT3G27100 unknown protein Lus10012534 18.7 0.7464
AT2G20490 NOP10, EDA27 EMBRYO SAC DEVELOPMENT ARREST ... Lus10033907 20.9 0.7283
AT5G24165 unknown protein Lus10014921 22.8 0.7016

Lus10033312 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.