Lus10033324 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G57170 118 / 3e-35 Tautomerase/MIF superfamily protein (.1.2)
AT5G01650 97 / 6e-27 Tautomerase/MIF superfamily protein (.1.2)
AT3G51660 58 / 8e-12 Tautomerase/MIF superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034783 132 / 5e-40 AT5G57170 116 / 4e-34 Tautomerase/MIF superfamily protein (.1.2)
Lus10022681 85 / 6e-22 AT5G01650 172 / 8e-57 Tautomerase/MIF superfamily protein (.1.2)
Lus10014233 82 / 1e-20 AT5G01650 169 / 1e-55 Tautomerase/MIF superfamily protein (.1.2)
Lus10012223 69 / 8e-16 AT5G01650 146 / 9e-47 Tautomerase/MIF superfamily protein (.1.2)
Lus10012222 63 / 1e-13 AT3G51660 158 / 1e-51 Tautomerase/MIF superfamily protein (.1)
Lus10000344 61 / 5e-13 AT3G51660 96 / 2e-27 Tautomerase/MIF superfamily protein (.1)
Lus10000345 47 / 7e-07 AT5G01650 52 / 2e-11 Tautomerase/MIF superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G075100 108 / 2e-31 AT5G57170 194 / 7e-66 Tautomerase/MIF superfamily protein (.1.2)
Potri.016G126500 96 / 1e-26 AT5G01650 193 / 2e-65 Tautomerase/MIF superfamily protein (.1.2)
Potri.016G126600 96 / 2e-26 AT5G01650 216 / 2e-74 Tautomerase/MIF superfamily protein (.1.2)
Potri.006G104500 93 / 2e-25 AT5G01650 200 / 5e-68 Tautomerase/MIF superfamily protein (.1.2)
Potri.016G126800 90 / 4e-24 AT5G01650 185 / 4e-62 Tautomerase/MIF superfamily protein (.1.2)
Potri.006G104600 89 / 2e-23 AT5G01650 180 / 3e-60 Tautomerase/MIF superfamily protein (.1.2)
Potri.016G126700 88 / 2e-23 AT5G01650 164 / 6e-54 Tautomerase/MIF superfamily protein (.1.2)
Potri.006G104800 63 / 2e-13 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1)
Potri.016G127300 62 / 5e-13 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0082 MIF PF01187 MIF Macrophage migration inhibitory factor (MIF)
Representative CDS sequence
>Lus10033324 pacid=23172121 polypeptide=Lus10033324 locus=Lus10033324.g ID=Lus10033324.BGIv1.0 annot-version=v1.0
ATGGGAGGGGAAGAGTCCAGTTTCAGACCACCCATTTTCGGGGGAGCAAGCTCTTATCCAGCCAGCACCAGTGGCGAAGAAGGAAGAAGAAGCAGCAGCA
GGGCGGCGGTGGAAAATGCCGACCTTGAATCTTATGTGATGATTGTGGTGAACAGCGGGGTACCTATGGCGTTTGGTGGTACGGAGGAGCCTGCTGCATT
TGGAGAATTGATTTCGATAGGGGGACTGGGGCCAACTGTCAACGGGAAGCTTAGTTCTACCATTGCAGAGATTCTTCAAACAAAGGCCTCCATCGATAGC
TCCCGATTTTACATCAAATTTTACGATGTTGAGGTTGCGATCAACCATAAGCAGCAGCGGCGGGAACAGGGAGAACTGTATTCTCCATCAGCCGCCATGA
ACTACCGTCGTCCGTCAGCAGCAGACTAG
AA sequence
>Lus10033324 pacid=23172121 polypeptide=Lus10033324 locus=Lus10033324.g ID=Lus10033324.BGIv1.0 annot-version=v1.0
MGGEESSFRPPIFGGASSYPASTSGEEGRRSSSRAAVENADLESYVMIVVNSGVPMAFGGTEEPAAFGELISIGGLGPTVNGKLSSTIAEILQTKASIDS
SRFYIKFYDVEVAINHKQQRREQGELYSPSAAMNYRRPSAAD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G57170 Tautomerase/MIF superfamily pr... Lus10033324 0 1
AT1G26480 GF14IOTA, GRF12 general regulatory factor 12 (... Lus10036471 7.2 0.8778
AT3G47860 CHL chloroplastic lipocalin (.1) Lus10037318 7.7 0.8624
AT1G32470 Single hybrid motif superfamil... Lus10035374 11.7 0.8796
AT5G08370 ATAGAL2 alpha-galactosidase 2 (.1.2) Lus10038305 12.0 0.8651
AT5G51010 Rubredoxin-like superfamily pr... Lus10027889 14.4 0.8234
AT5G23140 NCLPP7, NCLPP2,... nuclear-encoded CLP protease P... Lus10000063 15.3 0.8711
AT5G64350 FKP12, ATFKBP12... ARABIDOPSIS THALIANA FK506-BIN... Lus10016586 16.2 0.8241
AT4G11880 MADS AGL14 AGAMOUS-like 14 (.1) Lus10014144 19.4 0.8539
AT2G21530 FHA SMAD/FHA domain-containing pro... Lus10001966 21.6 0.8738
AT1G32470 Single hybrid motif superfamil... Lus10030979 22.8 0.8774

Lus10033324 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.