Plant FIBer expression Database

Lus10033326 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G16740 206 / 4e-70 Ribosomal protein L20 (.1)
ATCG00660 59 / 3e-12 ATCG00660.1, RPL20 ribosomal protein L20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034785
[exp]
256 / 3e-89 AT1G16740 212 / 2e-71 Ribosomal protein L20 (.1)
Lus10029597
[exp]
244 / 2e-85 AT1G16740 213 / 7e-73 Ribosomal protein L20 (.1)
Lus10006327
[exp]
243 / 1e-84 AT1G16740 213 / 1e-72 Ribosomal protein L20 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G119300
[exp]
223 / 1e-76 AT1G16740 235 / 1e-81 Ribosomal protein L20 (.1)
Potri.004G095475
[exp]
92 / 8e-26 AT1G16740 107 / 4e-32 Ribosomal protein L20 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00453 Ribosomal_L20 Ribosomal protein L20
Representative CDS sequence
>Lus10033326 pacid=23172153 polypeptide=Lus10033326 locus=Lus10033326.g ID=Lus10033326.BGIv1.0 annot-version=v1.0
ATGAACAAGAAGGAGATATTCAAGCTAGCTAAAGGGTTTAGGGGGAGAGCAAAGAACTGCATCAGGATAGCGAGAGAGAGGGTGGAGAAGGCGCTGCAGT
ATTCCTACAGGGACCGTAGGAACAAGAAGCGTGACATGCGCTCCCTATGGATTCAACGAATCAGTGCTGGCACCAGGCAACATCATGTTCATTATGGACA
CTTCATGCATGGGCTTAAGAAGGAGAACATCCAGCTGAACCGGAAAGTGTTGTCGGAGATATCTATGCACGAGCCGTGCAGTTTCAAGGCACTGGTAGAC
ATTTCTCGCACTGCTTTCCCGGGAAACAAACACATCTTCCATCGTCCCAGGAACGTGAACATGCCAATCAGTGCCTAG
AA sequence
>Lus10033326 pacid=23172153 polypeptide=Lus10033326 locus=Lus10033326.g ID=Lus10033326.BGIv1.0 annot-version=v1.0
MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRISAGTRQHHVHYGHFMHGLKKENIQLNRKVLSEISMHEPCSFKALVD
ISRTAFPGNKHIFHRPRNVNMPISA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G16740 Ribosomal protein L20 (.1) Lus10033326
[exp]
0 1
AT5G45190 Cyclin family protein (.1.2) Lus10038329
[exp]
5.5 0.8472
AT3G04400 EMB2171 embryo defective 2171, Ribosom... Lus10022882
[exp]
7.1 0.8647
AT1G26910 RPL10B ribosomal protein L10 B, Ribos... Lus10031568
[exp]
14.1 0.8075
AT5G45190 Cyclin family protein (.1.2) Lus10036192
[exp]
14.7 0.8312
AT2G28910 CXIP4 CAX interacting protein 4 (.1) Lus10004961
[exp]
15.2 0.8235
AT1G26910 RPL10B ribosomal protein L10 B, Ribos... Lus10012113
[exp]
20.2 0.8287
AT5G49210 unknown protein Lus10036792
[exp]
21.2 0.8001
AT2G04630 NRPE6B, NRPB6B RNA polymerase Rpb6 (.1) Lus10015000
[exp]
21.3 0.8413
AT3G59470 FAR1_related Far-red impaired responsive (F... Lus10020226
[exp]
23.0 0.8142
AT1G26340 B5 #6, B5#6, AT... ARABIDOPSIS CYTOCHROME B5 ISOF... Lus10036973
[exp]
23.7 0.8332

Lus10033326 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.