Lus10033346 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G16790 135 / 2e-41 ribosomal protein-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034801 239 / 2e-82 AT1G16790 140 / 1e-43 ribosomal protein-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G254100 158 / 2e-50 AT1G16790 155 / 1e-49 ribosomal protein-related (.1)
PFAM info
Representative CDS sequence
>Lus10033346 pacid=23172055 polypeptide=Lus10033346 locus=Lus10033346.g ID=Lus10033346.BGIv1.0 annot-version=v1.0
ATGCAACAACCGGCAACCCCGAATTCAGTCAGGCCAAACGAAGGCGGTGGAGGCAAGCCTTCGACGAAGAGGAAGCCGCCAACGCCCAAGGAGCTGATAT
CCCACTACGAGTCACAAGGGATGGAGCCCCAAGAGGCTTCCGCCAAGGTAATCGAAGACCTCCAGAAGGTTCTATACAGGGTTGTCTCCGCCAACAGCAA
GGGGAAAAAGAAAGACAAGGCTTCGTCGGAGGTTTCCCGGAAGATTGACGCGGTGAGCAACAGAGTGGCGGTGCTGGACATGAAGGTGGAGTCCAAGCCT
GGCTACCTCGGAGCTTTCAGCGTCGGAATCGCTTCGGGTGTGGCTCTGCGAGGGATTGAGAAGGTTTTGCCCAATGTTTGGGAAGGGATTGGTCAAATTT
GGAGCGCTGTTGGAAGTGTTACCACTAAGCCTCCATCTTCGTGA
AA sequence
>Lus10033346 pacid=23172055 polypeptide=Lus10033346 locus=Lus10033346.g ID=Lus10033346.BGIv1.0 annot-version=v1.0
MQQPATPNSVRPNEGGGGKPSTKRKPPTPKELISHYESQGMEPQEASAKVIEDLQKVLYRVVSANSKGKKKDKASSEVSRKIDAVSNRVAVLDMKVESKP
GYLGAFSVGIASGVALRGIEKVLPNVWEGIGQIWSAVGSVTTKPPSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G16790 ribosomal protein-related (.1) Lus10033346 0 1
AT1G04940 AtTic20-I, atTI... translocon at the inner envelo... Lus10010636 3.9 0.9296
AT4G36390 Methylthiotransferase (.1) Lus10041793 4.0 0.9290
AT4G36390 Methylthiotransferase (.1) Lus10028344 5.2 0.9154
AT4G38160 PDE191 pigment defective 191, Mitocho... Lus10026571 5.6 0.9330
AT3G21300 RNA methyltransferase family p... Lus10000172 6.0 0.9105
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Lus10039092 10.9 0.9314
AT1G47720 OSB1 Organellar Single-stranded, Pr... Lus10024852 13.3 0.8662
AT3G14110 FLU FLUORESCENT IN BLUE LIGHT, Tet... Lus10015677 16.7 0.9279
AT3G62030 CYP20-3, ROC4 cyclophilin 20-3, rotamase CYP... Lus10038015 16.9 0.8929
AT1G69200 FLN2 fructokinase-like 2 (.1) Lus10036920 20.5 0.8266

Lus10033346 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.