Lus10033357 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034812 62 / 5e-13 ND 51 / 7e-09
Lus10033358 64 / 9e-13 ND 57 / 1e-09
Lus10033359 61 / 4e-12 ND 54 / 6e-09
Lus10003550 61 / 5e-12 ND 51 / 1e-08
Lus10033897 59 / 1e-11 ND 51 / 4e-09
Lus10033898 58 / 2e-11 AT5G09530 52 / 1e-09 proline-rich protein 10, Pro-Glu-Leu|Ile|Val-Pro-Lys 1, hydroxyproline-rich glycoprotein family protein (.1)
Lus10033360 53 / 2e-09 AT4G38080 49 / 5e-08 hydroxyproline-rich glycoprotein family protein (.1)
Lus10034811 54 / 7e-09 AT1G50430 724 / 0.0 PARVA, LEPIDA, DWARF 5, DELTA5,7-STEROL DELTA7 REDUCTASE, Ergosterol biosynthesis ERG4/ERG24 family (.1.2)
Lus10034813 45 / 1e-06 AT5G09520 50 / 1e-08 Pro-Glu-Leu|Ile|Val-Pro-Lys 2, hydroxyproline-rich glycoprotein family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10033357 pacid=23172185 polypeptide=Lus10033357 locus=Lus10033357.g ID=Lus10033357.BGIv1.0 annot-version=v1.0
ATGGCCTCTTTCAACGGATTCGTACTTGGTCTCTTCATCGCCACCTTCGCATTTTCGAGCTTCAATGTTGGCCTAGCGGCTCGCCATCTCCTCCAGTTGC
CAACACTTCCACAGATCCCTACCACCACCCCGGCTCTCCCCCAGCCAACTCTTCCTACATTGCCGCCGATGCCCGCCGCAATTCCATCTCTCCCAAAGCC
AACACTGCCGTCATTGCCACCGATGCCCACTACGATGCCTACTCTCCCAAAGCCAACACTGCCATCATTGCCACCGATGCCCACCACGATGCCTACTCTT
CCCCAGCCAGCACAGCCTACCTTCCCTAAAACTACACTGCCCCCACTCCCAAGCATCCCTGCAGTGCCATTGCCAACCATCCCCAAAGCAACTTTCCCTC
CCATGCCGTCCATCCCTACCATTCCTTCCCTCGCCCCACCACCAAGCAAATAA
AA sequence
>Lus10033357 pacid=23172185 polypeptide=Lus10033357 locus=Lus10033357.g ID=Lus10033357.BGIv1.0 annot-version=v1.0
MASFNGFVLGLFIATFAFSSFNVGLAARHLLQLPTLPQIPTTTPALPQPTLPTLPPMPAAIPSLPKPTLPSLPPMPTTMPTLPKPTLPSLPPMPTTMPTL
PQPAQPTFPKTTLPPLPSIPAVPLPTIPKATFPPMPSIPTIPSLAPPPSK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G09530 PRP10, PELPK1 proline-rich protein 10, Pro-G... Lus10033357 0 1
AT1G74460 GDSL-like Lipase/Acylhydrolase... Lus10034459 1.0 0.9826
AT2G18360 alpha/beta-Hydrolases superfam... Lus10041747 2.8 0.9666
Lus10033358 3.5 0.9508
AT5G23190 CYP86B1 "cytochrome P450, family 86, s... Lus10017394 4.0 0.9519
AT5G23190 CYP86B1 "cytochrome P450, family 86, s... Lus10010193 4.2 0.9490
AT5G09530 PRP10, PELPK1 proline-rich protein 10, Pro-G... Lus10017818 4.2 0.9649
AT5G09530 PRP10, PELPK1 proline-rich protein 10, Pro-G... Lus10018841 5.0 0.9509
Lus10003550 7.5 0.9494
AT4G38080 hydroxyproline-rich glycoprote... Lus10033360 10.2 0.9503
AT2G39350 ABCG1 ATP-binding cassette G1, ABC-2... Lus10023465 11.4 0.9385

Lus10033357 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.