Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15733 71 / 7e-18 SCRL11 SCR-like 11 (.1) AT4G15735 54 / 8e-11 SCRL10 SCR-like 10 (.1) AT4G22115 50 / 1e-09 SCRL14 SCR-like 14 (.1) AT4G22105 46 / 6e-08 SCRL26 SCR-like 26 (.1) AT2G05117 45 / 2e-07 SCRL9 SCR-like 9 (.1) AT1G60986 36 / 0.0005 SCRL4 SCR-like 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034823 [exp] 158 / 1e-51 AT4G15733 66 / 7e-15 SCR-like 11 (.1) Lus10034824 [exp] 155 / 2e-50 AT4G15733 63 / 9e-14 SCR-like 11 (.1) Lus10033373 [exp] 144 / 2e-44 ND 64 / 3e-13 Lus10042791 [exp] 134 / 5e-43 AT4G15733 65 / 2e-15 SCR-like 11 (.1) Lus10029762 [exp] 112 / 4e-34 AT4G15733 60 / 1e-13 SCR-like 11 (.1) Lus10010504 [exp] 95 / 4e-27 AT4G22115 42 / 1e-06 SCR-like 14 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G162300 [exp] 80 / 2e-21 AT4G15733 57 / 3e-12 SCR-like 11 (.1) Potri.004G201100 [exp] 74 / 5e-19 AT4G15733 50 / 8e-10 SCR-like 11 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [flax] [poplar] Knottin_1 PF06876 [flax] [poplar] SCRL Plant self-incompatibility response (SCRL) protein
Representative CDS sequence Show only first row Show all	>Lus10033371 pacid=23172063 polypeptide=Lus10033371 locus=Lus10033371.g ID=Lus10033371.BGIv1.0 annot-version=v1.0 ATGGCGAAGCTTGCAATCGTATCAATGTTCGTTTGCCTCGTTCTCTTTCAGTTTGCTGCTGCGTCGCAGGAAGATGAGCTCAAATGGTGCCCAAAGACGG ACGTGTTCATAGGAGGATGCGGAGGGCCACAACAAGAGCAATGCCTTTTGGATTTTCTGGGAAAGTATGGAGCTAGCAGCATGCCCAAAAATTGCAGATG CACCCCTGCTGGCGCGAATCATTCTTGTACCTGTCAAGTTGTTTGCAGTGTTGCTAAAAATCTTTAA
AA sequence Show only first row Show all	>Lus10033371 pacid=23172063 polypeptide=Lus10033371 locus=Lus10033371.g ID=Lus10033371.BGIv1.0 annot-version=v1.0 MAKLAIVSMFVCLVLFQFAAASQEDELKWCPKTDVFIGGCGGPQQEQCLLDFLGKYGASSMPKNCRCTPAGANHSCTCQVVCSVAKNL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15733		SCRL11	SCR-like 11 (.1)		Lus10033371 [exp]	0	1

Compare expression of checked genes

Lus10033371 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.