Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14950 121 / 1e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G01520 119 / 8e-35 ZCE1, MLP328 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1) AT5G28010 118 / 3e-34 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G14940 117 / 3e-34 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2) AT1G14960 117 / 6e-34 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G01530 115 / 1e-33 ZCE2, MLP329 \(Zusammen-CA\)-enhanced 2, MLP-like protein 329 (.1) AT4G23680 114 / 7e-33 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT4G14060 112 / 3e-32 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G14930 112 / 3e-32 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70840 110 / 2e-31 MLP31 MLP-like protein 31 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008930 [exp] 231 / 8e-79 AT5G28010 126 / 2e-37 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10008932 [exp] 234 / 1e-78 AT4G14060 127 / 1e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10028887 [exp] 225 / 1e-76 AT2G01520 129 / 1e-38 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1) Lus10042489 [exp] 150 / 4e-47 AT1G14960 104 / 5e-29 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10042490 [exp] 145 / 3e-45 AT1G14930 107 / 3e-30 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10008931 [exp] 82 / 5e-21 AT1G70870 59 / 6e-13 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10020498 [exp] 82 / 5e-20 AT1G70830 160 / 7e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10020497 [exp] 80 / 2e-19 AT1G70840 148 / 4e-46 MLP-like protein 31 (.1) Lus10012466 [exp] 80 / 3e-19 AT1G70830 161 / 3e-51 MLP-like protein 28 (.1.2.3.4.5)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G131100 [exp] 159 / 2e-50 AT1G70890 107 / 3e-30 MLP-like protein 43 (.1) Potri.008G131200 [exp] 157 / 7e-50 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.008G131300 [exp] 134 / 6e-41 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.010G111000 [exp] 97 / 4e-26 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5) Potri.017G051100 [exp] 87 / 2e-22 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1) Potri.017G051200 [exp] 71 / 2e-16 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1) Potri.010G096000 [exp] 65 / 7e-14 AT1G24020 188 / 3e-62 MLP-like protein 423 (.1.2) Potri.004G051500 [exp] 59 / 2e-11 AT5G28010 69 / 4e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.004G020100 [exp] 41 / 0.0001 AT1G70880 58 / 5e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.013G131000 [exp] 39 / 0.0004 AT1G24020 62 / 1e-12 MLP-like protein 423 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF00407 [flax] [poplar] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Lus10033397 pacid=23172160 polypeptide=Lus10033397 locus=Lus10033397.g ID=Lus10033397.BGIv1.0 annot-version=v1.0 ATGGCGGCCGTGGACTCGTCGGCAATGAGTGGGAAGCTGGAGGCAGAGGTGGAGCTGAAAGCACCGCCGGCCAAGTTCTACGAAGTATTCAGGAAGACTG CACACCACGTCCCAACCCATGCTCCTTCCAACATTCAGGACGTTAAAGTCCACGAGGGCGACTGGGACTGTCATGACACCATCAAGATCTGGAACTACAC TTGTGAGGGGAAGGAAGAGGTGTTCAAGGAAAGGGTTGAATTCGACGACGCCAAGAAAATCGCCAAACTTGTCGGAGTGGATGGTGATGTGATGAAGATA TACAAAGTTTACAATGTAATCTACGAGTTGGTCGACCCTAAAGGCGATGGTGAACATGGAGTGGCCAAACTGGCTATCGAATATGAAAAGCTCGAACCCA ATGTCCCACCTCCGACCAAGTACATGGATTTCGTCGTCAGCCTTACCAAGAACCTTGATGCAGGCCTTGCCAACTCCGCCTGA
AA sequence Show only first row Show all	>Lus10033397 pacid=23172160 polypeptide=Lus10033397 locus=Lus10033397.g ID=Lus10033397.BGIv1.0 annot-version=v1.0 MAAVDSSAMSGKLEAEVELKAPPAKFYEVFRKTAHHVPTHAPSNIQDVKVHEGDWDCHDTIKIWNYTCEGKEEVFKERVEFDDAKKIAKLVGVDGDVMKI YKVYNVIYELVDPKGDGEHGVAKLAIEYEKLEPNVPPPTKYMDFVVSLTKNLDAGLANSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G14950			Polyketide cyclase/dehydrase a...		Lus10033397 [exp]	0	1
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10031151 [exp]	3.7	0.8809
AT5G50000			Protein kinase superfamily pro...		Lus10042129 [exp]	3.7	0.8548
AT4G15390			HXXXD-type acyl-transferase fa...		Lus10036042 [exp]	6.2	0.8176
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10012759 [exp]	9.5	0.8461
AT2G42250		CYP712A1	"cytochrome P450, family 712, ...		Lus10023827 [exp]	12.8	0.8289
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Lus10008611 [exp]	14.4	0.8535
					Lus10017937 [exp]	16.7	0.8316
AT4G29140		ADS1	ACTIVATED DISEASE SUSCEPTIBILI...		Lus10012944 [exp]	18.0	0.8481
AT2G20520		FLA6	FASCICLIN-like arabinogalactan...		Lus10033651 [exp]	19.0	0.8505
AT2G39170			unknown protein		Lus10028816 [exp]	20.6	0.8080

Compare expression of checked genes

Lus10033397 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.