Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17930 54 / 9e-10 Aminotransferase-like, plant mobile domain family protein (.1) AT2G04865 48 / 6e-08 Aminotransferase-like, plant mobile domain family protein (.1) AT2G25010 44 / 3e-06 Aminotransferase-like, plant mobile domain family protein (.1) AT1G48120 37 / 0.0007 hydrolases;protein serine/threonine phosphatases (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000720 [exp] 107 / 2e-31 AT1G17930 56 / 1e-09 Aminotransferase-like, plant mobile domain family protein (.1) Lus10003728 [exp] 104 / 4e-30 AT2G04865 54 / 5e-09 Aminotransferase-like, plant mobile domain family protein (.1) Lus10000607 [exp] 102 / 3e-28 AT2G25010 47 / 4e-06 Aminotransferase-like, plant mobile domain family protein (.1) Lus10011592 [exp] 99 / 3e-28 AT2G04865 49 / 2e-07 Aminotransferase-like, plant mobile domain family protein (.1) Lus10004447 [exp] 88 / 3e-24 AT1G17930 47 / 3e-07 Aminotransferase-like, plant mobile domain family protein (.1) Lus10020617 [exp] 84 / 3e-22 AT2G04865 40 / 3e-04 Aminotransferase-like, plant mobile domain family protein (.1) Lus10000686 [exp] 80 / 5e-20 AT1G17930 87 / 3e-20 Aminotransferase-like, plant mobile domain family protein (.1) Lus10033204 [exp] 76 / 4e-18 AT2G25010 50 / 4e-07 Aminotransferase-like, plant mobile domain family protein (.1) Lus10020970 [exp] 74 / 4e-17 AT1G17930 123 / 2e-30 Aminotransferase-like, plant mobile domain family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10536 [flax] [poplar] PMD Plant mobile domain
Representative CDS sequence Show only first row Show all	>Lus10033415 pacid=23172106 polypeptide=Lus10033415 locus=Lus10033415.g ID=Lus10033415.BGIv1.0 annot-version=v1.0 ATGACTCGGGAGTACAGTTGGGGTATGGCTAAACTAGCTTTCCTGTACATGCAGCTCGGGGTTGCTTCTCGTGCGGGATCTACATCCCTTTCAGGCTGCC TTACTGTGCTACAGTCGTGGATCTACGAGTACTTTCCGAGCTTGCGTTGTAGGCAGACCCTGACCCCAAGTGCTAGTGGGGAGGCACTTGCTGGGAGGTC GGACGGACCTACGATCGTTGAGAAAGCTGCTGATGACGATTTGAGGCTAGACACACTATGA
AA sequence Show only first row Show all	>Lus10033415 pacid=23172106 polypeptide=Lus10033415 locus=Lus10033415.g ID=Lus10033415.BGIv1.0 annot-version=v1.0 MTREYSWGMAKLAFLYMQLGVASRAGSTSLSGCLTVLQSWIYEYFPSLRCRQTLTPSASGEALAGRSDGPTIVEKAADDDLRLDTL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G17930			Aminotransferase-like, plant m...		Lus10033415 [exp]	0	1
AT1G64870			unknown protein		Lus10002022 [exp]	1.0	0.9580
AT5G46795		MSP2	microspore-specific promoter ...		Lus10000907 [exp]	3.6	0.7468
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10039330 [exp]	5.2	0.6923
AT5G38460			ALG6, ALG8 glycosyltransferase...		Lus10033554 [exp]	6.5	0.7146
AT3G02100			UDP-Glycosyltransferase superf...		Lus10003456 [exp]	8.1	0.8162
AT5G02280			SNARE-like superfamily protein...		Lus10023793 [exp]	8.4	0.6650
AT4G29340		PRF4	profilin 4 (.1)		Lus10012935 [exp]	9.9	0.8162
					Lus10013299 [exp]	10.8	0.6909
AT2G31180	MYB	ATMYB14, Myb14a...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10022021 [exp]	11.5	0.8162
					Lus10035698 [exp]	12.2	0.6951

Compare expression of checked genes

Lus10033415 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.