Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26210 156 / 7e-49 Ankyrin repeat family protein (.1.2.3) AT5G66055 51 / 1e-07 EMB16, EMB2036, AKRP EMBRYO DEFECTIVE 2036, EMBRYO DEFECTIVE 16, ankyrin repeat protein (.1.2) AT3G58760 49 / 8e-07 Integrin-linked protein kinase family (.1) AT2G26650 48 / 1e-06 AKT1, ATAKT1 K+ transporter 1, K+ transporter 1, K+ transporter 1 (.1) AT4G18950 46 / 6e-06 Integrin-linked protein kinase family (.1) AT2G31800 44 / 2e-05 Integrin-linked protein kinase family (.1) AT5G07840 44 / 2e-05 PIA1 phytochrome interacting ankyrin-repeat protein 1, Ankyrin repeat family protein (.1) AT5G61230 43 / 3e-05 PIA2, ANK6 phytochrome interacting ankyrin-repeat protein 2, ankyrin repeat protein 6, Ankyrin repeat family protein (.1) AT3G59830 43 / 5e-05 Integrin-linked protein kinase family (.1) AT5G37500 42 / 0.0001 GORK gated outwardly-rectifying K+ channel, gated outwardly-rectifying K+ channel (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034882 [exp] 209 / 5e-68 AT2G26210 165 / 2e-50 Ankyrin repeat family protein (.1.2.3) Lus10041853 [exp] 50 / 2e-07 AT5G66055 465 / 2e-162 EMBRYO DEFECTIVE 2036, EMBRYO DEFECTIVE 16, ankyrin repeat protein (.1.2) Lus10036033 [exp] 49 / 3e-07 AT5G12320 186 / 2e-61 ankyrin repeat family protein (.1) Lus10029277 [exp] 46 / 5e-06 AT4G18950 601 / 0.0 Integrin-linked protein kinase family (.1) Lus10009696 [exp] 45 / 5e-06 AT5G12320 184 / 7e-61 ankyrin repeat family protein (.1) Lus10043298 [exp] 45 / 1e-05 AT2G26650 1250 / 0.0 K+ transporter 1, K+ transporter 1, K+ transporter 1 (.1) Lus10019442 [exp] 45 / 1e-05 AT2G26650 1252 / 0.0 K+ transporter 1, K+ transporter 1, K+ transporter 1 (.1) Lus10007432 [exp] 44 / 3e-05 AT2G31800 69 / 3e-13 Integrin-linked protein kinase family (.1) Lus10030387 [exp] 43 / 5e-05 AT3G58760 315 / 2e-103 Integrin-linked protein kinase family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G047000 [exp] 191 / 5e-61 AT2G26210 217 / 4e-71 Ankyrin repeat family protein (.1.2.3) Potri.006G217100 [exp] 190 / 1e-60 AT2G26210 209 / 8e-68 Ankyrin repeat family protein (.1.2.3) Potri.009G070700 [exp] 52 / 9e-09 AT5G12320 197 / 6e-66 ankyrin repeat family protein (.1) Potri.010G185200 [exp] 52 / 4e-08 AT2G03430 76 / 3e-15 Ankyrin repeat family protein (.1) Potri.005G105800 [exp] 50 / 2e-07 AT5G66055 457 / 3e-159 EMBRYO DEFECTIVE 2036, EMBRYO DEFECTIVE 16, ankyrin repeat protein (.1.2) Potri.004G064400 [exp] 47 / 2e-06 AT4G18950 632 / 0.0 Integrin-linked protein kinase family (.1) Potri.001G276100 [exp] 45 / 2e-06 AT5G12320 191 / 1e-63 ankyrin repeat family protein (.1) Potri.018G071400 [exp] 46 / 5e-06 AT2G26650 1192 / 0.0 K+ transporter 1, K+ transporter 1, K+ transporter 1 (.1) Potri.013G062000 [exp] 45 / 7e-06 AT2G03430 94 / 2e-21 Ankyrin repeat family protein (.1) Potri.007G060400 [exp] 45 / 8e-06 AT5G66055 462 / 2e-161 EMBRYO DEFECTIVE 2036, EMBRYO DEFECTIVE 16, ankyrin repeat protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0465 [flax] [poplar] Ank PF00023 [flax] [poplar] Ank Ankyrin repeat
Representative CDS sequence Show only first row Show all	>Lus10033419 pacid=23172154 polypeptide=Lus10033419 locus=Lus10033419.g ID=Lus10033419.BGIv1.0 annot-version=v1.0 ATGGCGCTGGAGCCTCCGCCTTTCCAAGAAGCAGATCGTTGCGATGTGTGCAAGTGTGGCTTTAGCGCTTTTCGCCGCCGGGCAAAAGCAGCATCAGCAT CTGCATCACATTCAAATCCAAGACCTAAGAAGATAGATGCAACTTCTAAAATCAGAGCTTCCAGTTCCAGTGCCAATCCTGTGTTGATTTCCAACAATGG CCAGATTACTAGTGGCGCTACTGAAAAACATCAGAAGCATTATGAAGCTAACGGGGAGGGTTTAAGGGAAGCAATAAAGAATGATGATTCTGCTGCTGTA AGGAAGCTTGTCAGTCAGGGTGTAGATGCAAATTATCAAGACCGACAAGGAATGTCTCTCCTACATATGGCTGCTGTATTCAACCGAACGGACATTGTCT TTATCCTGATGGAATCTGGAGCAAATCTAGACTGCAGAAACGCGCAAGGGGAAACTCCACTTGATTGCGCACCGGCAACATTGCAGTACAAGATGAGAAA GAAAATGCAAGAAACTGGGGAGGACAACCCACAAATCAACGTTTGA
AA sequence Show only first row Show all	>Lus10033419 pacid=23172154 polypeptide=Lus10033419 locus=Lus10033419.g ID=Lus10033419.BGIv1.0 annot-version=v1.0 MALEPPPFQEADRCDVCKCGFSAFRRRAKAASASASHSNPRPKKIDATSKIRASSSSANPVLISNNGQITSGATEKHQKHYEANGEGLREAIKNDDSAAV RKLVSQGVDANYQDRQGMSLLHMAAVFNRTDIVFILMESGANLDCRNAQGETPLDCAPATLQYKMRKKMQETGEDNPQINV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G26210			Ankyrin repeat family protein ...		Lus10033419 [exp]	0	1
AT4G07390			Mannose-P-dolichol utilization...		Lus10017025 [exp]	9.3	0.8738
AT1G50740			Transmembrane proteins 14C (.1...		Lus10008541 [exp]	10.4	0.8803
AT3G47610			transcription regulators;zinc ...		Lus10023596 [exp]	13.8	0.8710
AT1G64230		UBC28	ubiquitin-conjugating enzyme 2...		Lus10022726 [exp]	17.5	0.8783
AT1G10430		PP2A-2	protein phosphatase 2A-2 (.1)		Lus10030810 [exp]	33.7	0.8719
AT1G72710		CKL2	casein kinase 1-like protein 2...		Lus10037621 [exp]	34.2	0.8676
AT1G23440			Peptidase C15, pyroglutamyl pe...		Lus10029137 [exp]	34.6	0.8695
AT3G46060		ARA3, Ara-3, At...	RAB GTPase homolog 8A (.1.2.3)		Lus10023430 [exp]	37.0	0.8521
AT5G17290		ATG5, APG5, ATA...	AUTOPHAGY 5, autophagy protein...		Lus10020737 [exp]	37.2	0.8387
AT5G63620			GroES-like zinc-binding alcoho...		Lus10039625 [exp]	37.5	0.8351

Compare expression of checked genes

Lus10033419 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.