Lus10033424 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26060 278 / 1e-95 ATPRXQ ,ATPRX Q peroxiredoxin Q, Thioredoxin superfamily protein (.1.2)
AT5G06290 79 / 1e-17 2CPB, 2-CysPrxB ,2-Cys Prx B 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
AT3G11630 76 / 2e-16 Thioredoxin superfamily protein (.1)
AT1G48130 47 / 3e-06 ATPER1 1-cysteine peroxiredoxin 1 (.1)
AT2G25080 41 / 0.0002 ATGPX1 glutathione peroxidase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034892 407 / 9e-147 AT3G26060 281 / 6e-97 peroxiredoxin Q, Thioredoxin superfamily protein (.1.2)
Lus10016969 82 / 1e-18 AT5G06290 403 / 2e-143 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
Lus10021295 82 / 1e-18 AT5G06290 404 / 6e-144 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
Lus10018342 42 / 9e-05 AT1G48130 338 / 2e-119 1-cysteine peroxiredoxin 1 (.1)
Lus10026887 42 / 0.0001 AT4G31870 332 / 3e-116 glutathione peroxidase 7 (.1)
Lus10017112 41 / 0.0003 AT1G48130 335 / 3e-118 1-cysteine peroxiredoxin 1 (.1)
Lus10003421 40 / 0.0007 AT4G31870 319 / 9e-110 glutathione peroxidase 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G137500 317 / 3e-111 AT3G26060 286 / 5e-99 peroxiredoxin Q, Thioredoxin superfamily protein (.1.2)
Potri.018G063300 306 / 9e-107 AT3G26060 275 / 1e-94 peroxiredoxin Q, Thioredoxin superfamily protein (.1.2)
Potri.006G204900 82 / 1e-18 AT5G06290 385 / 2e-136 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
Potri.016G072100 77 / 5e-17 AT5G06290 390 / 3e-138 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
Potri.008G099900 42 / 0.0001 AT1G48130 322 / 2e-111 1-cysteine peroxiredoxin 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00578 AhpC-TSA AhpC/TSA family
Representative CDS sequence
>Lus10033424 pacid=23172046 polypeptide=Lus10033424 locus=Lus10033424.g ID=Lus10033424.BGIv1.0 annot-version=v1.0
ATGGCTTCCATTTCGCTTCCGAAGCATTGTTCCATTTGTCCAACAATCTGGTCTCCTAATAAACCCATATTTCCATCTTCCCAACATCTACCATATAATT
CTCAGCCCAAATTCAATGGCCTCAGGTTCTCCAATTCCGTCACTGCACCTCGTCATCTCGCTTTCAAGCCCTCCATCGTCGCTGCGAAGGTGAACAAAGG
TCAGGTACCACCATCCTTCACATTGAAAGATCAAGATGGTAAGGCTGTAAGCCTCTCCAAGTTCAAGGGCAAGCCTGTAGTTCTCTATTTCTATCCGGCT
GATGAATCCCCTAGCTGCACTAAACAGGCTTGTGCTTTCAGGGATTCGTATGAGAAGTTTAAGAAAGCAGGAGCTGAGGTTGTTGGGATTAGTGGTGATG
ATTCATCGTCTCACAAGTCATTTGCTAAGAAGTATAGGCTGCCATTTACATTACTTAGCGACGAGGGTAACAAAGTAAGGAAAGATTGGGGTGTCCCTTC
TGATCTTTTTGGAGCATTGCCTGGGAGACAGACTTATGTTTTGGATAAGAAGGGAGTGGTTCAGCTCATCTATAATAACCAGTTCCAACCTGAGAAGCAC
ATTGATGAAACTCTCAAGCTACTTCAAACGCTTTGA
AA sequence
>Lus10033424 pacid=23172046 polypeptide=Lus10033424 locus=Lus10033424.g ID=Lus10033424.BGIv1.0 annot-version=v1.0
MASISLPKHCSICPTIWSPNKPIFPSSQHLPYNSQPKFNGLRFSNSVTAPRHLAFKPSIVAAKVNKGQVPPSFTLKDQDGKAVSLSKFKGKPVVLYFYPA
DESPSCTKQACAFRDSYEKFKKAGAEVVGISGDDSSSHKSFAKKYRLPFTLLSDEGNKVRKDWGVPSDLFGALPGRQTYVLDKKGVVQLIYNNQFQPEKH
IDETLKLLQTL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G26060 ATPRXQ ,ATPRX Q peroxiredoxin Q, Thioredoxin s... Lus10033424 0 1
AT3G26060 ATPRXQ ,ATPRX Q peroxiredoxin Q, Thioredoxin s... Lus10034892 1.0 0.9732
AT3G44890 RP19, RPL9 ribosomal protein L9 (.1) Lus10037372 4.9 0.9667
AT5G45680 ATFKBP13 FK506 BINDING PROTEIN 13, FK50... Lus10006949 6.2 0.9599
AT5G40950 RPL27 ribosomal protein large subuni... Lus10012538 8.9 0.9537
AT4G29590 S-adenosyl-L-methionine-depend... Lus10040550 9.5 0.9503
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Lus10035036 11.5 0.9479
AT5G21920 ATYLMG2 YGGT family protein (.1.2) Lus10009622 12.4 0.9117
AT5G19220 ADG2, APL1 ADP GLUCOSE PYROPHOSPHORYLASE ... Lus10034053 14.7 0.9336
AT1G45474 LHCA5 photosystem I light harvesting... Lus10042657 15.3 0.9331
AT2G40490 HEME2 Uroporphyrinogen decarboxylase... Lus10030544 15.6 0.9247

Lus10033424 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.