Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G06520 69 / 4e-16 PSBX photosystem II subunit X (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025007 [exp] 84 / 3e-22 AT2G06520 72 / 3e-17 photosystem II subunit X (.1) Lus10026458 [exp] 77 / 5e-19 AT2G06520 74 / 3e-18 photosystem II subunit X (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G144000 [exp] 103 / 1e-29 AT2G06520 97 / 6e-27 photosystem II subunit X (.1) Potri.018G065200 [exp] 100 / 1e-28 AT2G06520 100 / 1e-28 photosystem II subunit X (.1) Potri.006G222300 [exp] 94 / 4e-26 AT2G06520 80 / 2e-20 photosystem II subunit X (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06596 [flax] [poplar] PsbX Photosystem II reaction centre X protein (PsbX)
Representative CDS sequence Show only first row Show all	>Lus10033434 pacid=23172212 polypeptide=Lus10033434 locus=Lus10033434.g ID=Lus10033434.BGIv1.0 annot-version=v1.0 ATGGCTACTTCAACTTCAGCCGTGTCATTGGCCGCCATGCCATTAACCTACGCTAGCCGGAACAAGTCACCGGCATCTTCTCCACTGTCCTTTAGGCCTC TCCCATCCAGGCCTTCGACTGGGAGATCCAAATTCCAAGTCAAGGCTTCCCTCAAGGAGAAGGCTGTCACCGGATTGACCGCCGCTGTTCTCACCGCTTC CATGGTCATCCCCGACGTGGCTCAAGCAGCTGAAGTCAGCCCTTCCCTCAAGAACTTCTTGCTCAGCATTGCTGCCGGTGGCACTGTTCTCACTGCCATC ATCGGTGCTATTGTTGGTGTCTCCAATTTCGACCCTGTCAAGCGTAGCTAA
AA sequence Show only first row Show all	>Lus10033434 pacid=23172212 polypeptide=Lus10033434 locus=Lus10033434.g ID=Lus10033434.BGIv1.0 annot-version=v1.0 MATSTSAVSLAAMPLTYASRNKSPASSPLSFRPLPSRPSTGRSKFQVKASLKEKAVTGLTAAVLTASMVIPDVAQAAEVSPSLKNFLLSIAAGGTVLTAI IGAIVGVSNFDPVKRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G06520		PSBX	photosystem II subunit X (.1)		Lus10033434 [exp]	0	1
AT1G03130		PSAD-2	photosystem I subunit D-2 (.1)		Lus10041209 [exp]	2.8	0.9572
AT4G01150			unknown protein		Lus10010132 [exp]	3.5	0.9567
AT4G03280		PGR1, PETC	PROTON GRADIENT REGULATION 1, ...		Lus10039739 [exp]	3.6	0.9592
AT3G61870			unknown protein		Lus10010112 [exp]	4.5	0.9532
AT1G03130		PSAD-2	photosystem I subunit D-2 (.1)		Lus10021923 [exp]	5.0	0.9523
AT1G06680		PSII-P, OEE2, P...	OXYGEN-EVOLVING ENHANCER PROTE...		Lus10029823 [exp]	6.3	0.9485
AT4G22890		PGR5-LIKEA, PGR...	PGR5-LIKE A (.1.2.3.4.5)		Lus10006710 [exp]	6.9	0.9500
AT5G02120		PDE335, OHP	PIGMENT DEFECTIVE 335, one hel...		Lus10003965 [exp]	7.4	0.9454
AT4G00030			Plastid-lipid associated prote...		Lus10020912 [exp]	9.3	0.9222
AT5G66190		ATLFNR1	ferredoxin-NADP\(+\)-oxidoredu...		Lus10028451 [exp]	9.5	0.9497

Compare expression of checked genes

Lus10033434 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.