Lus10033457 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G49142 153 / 7e-44 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G02750 152 / 2e-43 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G22690 147 / 1e-41 unknown protein
AT1G20230 147 / 2e-41 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G26782 145 / 3e-41 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G40410 144 / 5e-41 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G21065 140 / 4e-40 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT2G29760 142 / 7e-40 OTP81 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G21300 142 / 1e-39 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G40405 141 / 1e-39 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020918 298 / 2e-99 AT2G29760 474 / 3e-159 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10031989 149 / 2e-42 AT3G26782 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10029344 143 / 2e-40 AT5G06540 803 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10016387 140 / 4e-40 AT4G33990 717 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10005638 135 / 6e-40 AT5G40410 305 / 9e-101 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10002553 136 / 8e-40 AT2G22410 365 / 3e-122 SLOW GROWTH 1 (.1)
Lus10033026 142 / 9e-40 AT1G08070 921 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10008967 142 / 1e-39 AT4G21300 876 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10039117 141 / 1e-39 AT3G24000 740 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G217900 202 / 2e-62 AT2G22410 530 / 0.0 SLOW GROWTH 1 (.1)
Potri.005G005700 152 / 1e-43 AT3G49142 912 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G012600 152 / 1e-43 AT2G29760 540 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G065500 148 / 3e-42 AT5G06540 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G119000 147 / 5e-42 AT5G44230 792 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.017G001000 147 / 6e-42 AT4G21065 793 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.002G021300 147 / 1e-41 AT1G20230 852 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.012G135600 145 / 4e-41 AT4G38010 672 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.009G044700 144 / 8e-41 AT2G29760 1013 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G083700 144 / 1e-40 AT3G22690 1050 / 0.0 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10033457 pacid=23143272 polypeptide=Lus10033457 locus=Lus10033457.g ID=Lus10033457.BGIv1.0 annot-version=v1.0
ATGGAACACTATGCTTGTATGATTGATCTGCTTGGTCGGGCTGGGCTTCTAGAAGATGCATATAAGCTGATAAGCTGGATGCCAATGGCACCGGGGCAAG
CTGCCTGGGGTGCCCTTTTGAATGCTTGCAGGATGCATGGGAATATTGAACTGGCCAAGCTTGCTGCTCATAAACTTTTTGAGTTAGATCCTGAAGACAG
TGGTATATATGTTTTGTTAGCAACTGTTGTTTATGCCAGGGACAAGAGATGGGGCGATGTGAGTATGGTAAGAAACATAATGAAGGAAAAGGGCGTTAAG
AAAACTCCCGGTCGAAGCTTGATAGAGATTGAAGGGGATTTCCATGAGTTCCTAGCTGGAGACACTTCACATCCACAGTCTCATGGAATTCGTCAAGCTT
TGAAGGACATATTTATGTTGTCGAAAATGGAAGATGCTGACGGCAATGAGCCTCTAAATTACATTTTATAA
AA sequence
>Lus10033457 pacid=23143272 polypeptide=Lus10033457 locus=Lus10033457.g ID=Lus10033457.BGIv1.0 annot-version=v1.0
MEHYACMIDLLGRAGLLEDAYKLISWMPMAPGQAAWGALLNACRMHGNIELAKLAAHKLFELDPEDSGIYVLLATVVYARDKRWGDVSMVRNIMKEKGVK
KTPGRSLIEIEGDFHEFLAGDTSHPQSHGIRQALKDIFMLSKMEDADGNEPLNYIL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G49142 Tetratricopeptide repeat (TPR)... Lus10033457 0 1
AT3G14470 NB-ARC domain-containing disea... Lus10039540 24.3 0.6890
AT2G32010 CVL1 CVP2 like 1 (.1.2) Lus10006597 25.9 0.6851
AT5G57300 S-adenosyl-L-methionine-depend... Lus10037553 83.8 0.5662
AT1G02420 Pentatricopeptide repeat (PPR)... Lus10026306 173.5 0.5782
AT3G26950 unknown protein Lus10035181 259.8 0.5668

Lus10033457 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.