Lus10033498 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10033498 pacid=23143299 polypeptide=Lus10033498 locus=Lus10033498.g ID=Lus10033498.BGIv1.0 annot-version=v1.0
ATGAGCTCCAAATTTGTTTTTGCTCTGCTCAGCCTTCTTCTGGTTACGATGCTGCTGATGCATACTCCAACTGTGGGTGCTGCCGCTCCGGTCCCACGCG
ATCAGAGTGGCGATGATGGATCCGTACAACCAGCTGGGAAGATCTACAAGCCAGGGTGCAGAGGATCATTGGCTCTATGCGGAAGTTACGCTAATTGCTG
TTATTGTAGCAACATCTATGGATGCACTTCTTGTTGCAACACTTAA
AA sequence
>Lus10033498 pacid=23143299 polypeptide=Lus10033498 locus=Lus10033498.g ID=Lus10033498.BGIv1.0 annot-version=v1.0
MSSKFVFALLSLLLVTMLLMHTPTVGAAAPVPRDQSGDDGSVQPAGKIYKPGCRGSLALCGSYANCCYCSNIYGCTSCCNT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10033498 0 1
AT1G12064 unknown protein Lus10039031 1.4 0.8883
AT1G02010 SEC1A secretory 1A (.1.2) Lus10009293 5.1 0.7054
Lus10014474 6.9 0.7969
AT3G27030 unknown protein Lus10041551 8.5 0.7772
AT2G15220 Plant basic secretory protein ... Lus10038602 9.0 0.7050
AT4G39700 Heavy metal transport/detoxifi... Lus10022508 11.1 0.7814
AT1G75290 NAD(P)-binding Rossmann-fold s... Lus10021709 12.0 0.7807
AT4G39950 CYP79B2 "cytochrome P450, family 79, s... Lus10031726 12.6 0.7805
AT1G07410 ATRAB-A2B, AtRA... ARABIDOPSIS RAB GTPASE HOMOLOG... Lus10040255 21.9 0.7503
Lus10024757 23.8 0.7769

Lus10033498 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.