Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G09225 73 / 3e-18 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020870 [exp] 86 / 3e-23 AT5G09225 74 / 1e-19 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G036400 [exp] 77 / 5e-20 AT5G09225 72 / 6e-19 unknown protein Potri.006G039100 [exp] 77 / 8e-20 AT5G09225 66 / 3e-16 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033507 pacid=23143311 polypeptide=Lus10033507 locus=Lus10033507.g ID=Lus10033507.BGIv1.0 annot-version=v1.0 ATGCCACACCGGACTCGGCCTATGACCGCATTGTTGGTGTTCACTGGACTCAATGTAGTCTTGGTTCAAACCATTACTCCTGTCTATGATTTCGTGTGTT TCCTTCCTTATTGGGAAAGACGGGAATTGTATGGTTTCTGCTATCCTCTTAGCTCGAGTATGATTTGGAGAATGTTTCATGATCATGCTATGTTTGCTGA TAGAAGTCCTGCATATTTAATCACAGTCCGAAGTTATTTTTGCAGAGAGAACAAAGACGTCAAGAACGTGAAGCCCGTACGAGATCAAGTTCCATGTAGT TTGCACATTGCATGGATGACTATGGTGTTACAAACTCGGGAATGA
AA sequence Show only first row Show all	>Lus10033507 pacid=23143311 polypeptide=Lus10033507 locus=Lus10033507.g ID=Lus10033507.BGIv1.0 annot-version=v1.0 MPHRTRPMTALLVFTGLNVVLVQTITPVYDFVCFLPYWERRELYGFCYPLSSSMIWRMFHDHAMFADRSPAYLITVRSYFCRENKDVKNVKPVRDQVPCS LHIAWMTMVLQTRE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G09225			unknown protein		Lus10033507 [exp]	0	1
AT1G62930		RPF3	RNA processing factor 3, Tetra...		Lus10021074 [exp]	8.5	0.6599
AT1G26880			Ribosomal protein L34e superfa...		Lus10042199 [exp]	13.4	0.7036
					Lus10027262 [exp]	18.7	0.6934
AT4G29660		EMB2752	embryo defective 2752 (.1)		Lus10032908 [exp]	52.3	0.6037
AT5G25752		ATRBL11	ARABIDOPSIS RHOMBOID-LIKE PROT...		Lus10011680 [exp]	72.7	0.6359
AT2G19740			Ribosomal protein L31e family ...		Lus10018032 [exp]	99.5	0.6261
AT4G18100			Ribosomal protein L32e (.1)		Lus10031699 [exp]	104.8	0.6236
AT4G35540			zinc ion binding;transcription...		Lus10030407 [exp]	125.5	0.5960
AT1G11340			S-locus lectin protein kinase ...		Lus10002717 [exp]	146.8	0.5965
AT3G44380			Late embryogenesis abundant (L...		Lus10020628 [exp]	215.8	0.5675

Compare expression of checked genes

Lus10033507 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.