Lus10033514 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G09820 268 / 1e-90 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
AT4G22240 69 / 2e-13 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT3G26070 66 / 1e-12 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT4G04020 63 / 2e-11 FIB fibrillin (.1)
AT2G35490 56 / 7e-09 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT3G23400 53 / 4e-08 FIB4 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT4G00030 52 / 5e-08 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT3G26080 51 / 1e-07 plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT5G19940 43 / 7e-05 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020860 457 / 6e-166 AT5G09820 269 / 5e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Lus10020982 68 / 2e-13 AT3G26070 265 / 1e-89 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10014790 67 / 8e-13 AT4G22240 363 / 2e-126 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10001099 66 / 3e-12 AT4G22240 362 / 5e-126 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10030987 57 / 3e-09 AT2G35490 354 / 5e-121 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10020912 56 / 4e-09 AT4G00030 276 / 2e-94 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10035384 56 / 6e-09 AT2G35490 357 / 5e-122 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10021209 52 / 7e-08 AT3G23400 305 / 4e-104 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10011803 49 / 8e-07 AT3G23400 307 / 5e-105 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G309300 303 / 1e-104 AT5G09820 268 / 7e-90 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Potri.004G003200 71 / 3e-14 AT4G22240 380 / 1e-132 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.001G209600 64 / 6e-12 AT3G26070 253 / 7e-85 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.003G020700 64 / 1e-11 AT3G26070 244 / 6e-81 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.003G095900 54 / 2e-08 AT2G35490 334 / 5e-113 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.014G058400 52 / 7e-08 AT4G00030 282 / 2e-97 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.001G137900 52 / 8e-08 AT2G35490 301 / 3e-100 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.008G169100 43 / 9e-05 AT3G23400 267 / 2e-89 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04755 PAP_fibrillin PAP_fibrillin
Representative CDS sequence
>Lus10033514 pacid=23143244 polypeptide=Lus10033514 locus=Lus10033514.g ID=Lus10033514.BGIv1.0 annot-version=v1.0
ATGGCGTTTACTCATTCACAACTATGGACAATGAAGAATCAGCAGCAGCAGGGCAAGAGTGGAATCAAAGTTGCACCACAGAGTAGTAGTTCATCCTCCT
CTTTGAAAGTCTCGGAAGTCAAGGAGCATCTTTACCAAGCTCTCCAGGGGATTAACAGAGGGGTATTTGGGACAACATCTGCAAAGAAATCTGAGATTCA
GGAGCTGGTTGAGCTGCTTGAGTCCCAGAACCCAACTCCAGATCCCACTCTCAGTCTCCACAAGGTGGATGGCTGCTGGAAACTAGTGTACAGCACAATC
AGCATACTGGGTGCAAAGAGGACAAAGCTGGGATTGAGAGATTTCATCACCTTAGGGGATCTCTTCCAAATCATTGATGTAGCTGAGAGCAAAGCGGTCA
ATGTGATGAAGTTCAACGTTAGAGGACTCAACCTCTTGAATGGGCAGCTTACAATTGTAGCCTCCTTCAAGATTGCTTCCAAATCAAGAGTTGGGATTAA
ATACATAGGTTCAAGGATAACACCTGAGCAGCTGATGAACGTGTTCCAGAAGAACTATGATCTTCTGCTCAGCATCTTCAATCCAGAAGGATGGCTTGAG
CTCACATATGTTGACGATGAGATGAGGATAGGAAGAGATGAAAAGGGTAATATCTTTGTGTTGGAGAGATCCCATGAACAAATTGACTCTTCCATTGCTC
AGAATTGA
AA sequence
>Lus10033514 pacid=23143244 polypeptide=Lus10033514 locus=Lus10033514.g ID=Lus10033514.BGIv1.0 annot-version=v1.0
MAFTHSQLWTMKNQQQQGKSGIKVAPQSSSSSSSLKVSEVKEHLYQALQGINRGVFGTTSAKKSEIQELVELLESQNPTPDPTLSLHKVDGCWKLVYSTI
SILGAKRTKLGLRDFITLGDLFQIIDVAESKAVNVMKFNVRGLNLLNGQLTIVASFKIASKSRVGIKYIGSRITPEQLMNVFQKNYDLLLSIFNPEGWLE
LTYVDDEMRIGRDEKGNIFVLERSHEQIDSSIAQN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G09820 Plastid-lipid associated prote... Lus10033514 0 1
AT5G56850 unknown protein Lus10008560 2.0 0.9373
AT5G09820 Plastid-lipid associated prote... Lus10020860 3.2 0.9236
AT5G12130 ATTERC, PDE149 PIGMENT DEFECTIVE 149, TELLURI... Lus10019895 4.6 0.8980
AT2G32500 Stress responsive alpha-beta b... Lus10015134 7.5 0.9116
AT5G22800 EMB86, EMB263, ... EMBRYO DEFECTIVE 86, EMBRYO DE... Lus10003337 11.1 0.9143
AT2G21280 GC1, ATSULA GIANT CHLOROPLAST 1, NAD(P)-bi... Lus10018055 12.3 0.8973
AT2G47240 CER8, LACS1 LONG-CHAIN ACYL-COA SYNTHASE 1... Lus10002414 15.5 0.8840
AT5G22800 EMB86, EMB263, ... EMBRYO DEFECTIVE 86, EMBRYO DE... Lus10022640 16.6 0.9096
AT3G18500 DNAse I-like superfamily prote... Lus10014775 18.7 0.8736
AT5G56850 unknown protein Lus10032679 19.3 0.8773

Lus10033514 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.