Lus10033521 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G49170 146 / 2e-46 Protein of unknown function (DUF167) (.1)
AT5G63440 46 / 9e-07 Protein of unknown function (DUF167) (.1), Protein of unknown function (DUF167) (.2), Protein of unknown function (DUF167) (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020853 131 / 2e-40 AT1G49170 107 / 2e-31 Protein of unknown function (DUF167) (.1)
Lus10042819 84 / 1e-21 AT1G49170 54 / 4e-10 Protein of unknown function (DUF167) (.1)
Lus10016760 47 / 9e-07 AT5G63440 439 / 8e-159 Protein of unknown function (DUF167) (.1), Protein of unknown function (DUF167) (.2), Protein of unknown function (DUF167) (.3)
Lus10022455 47 / 1e-06 AT5G63440 439 / 9e-159 Protein of unknown function (DUF167) (.1), Protein of unknown function (DUF167) (.2), Protein of unknown function (DUF167) (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G056500 160 / 9e-52 AT1G49170 172 / 1e-56 Protein of unknown function (DUF167) (.1)
Potri.015G094300 44 / 6e-06 AT5G63440 429 / 5e-155 Protein of unknown function (DUF167) (.1), Protein of unknown function (DUF167) (.2), Protein of unknown function (DUF167) (.3)
Potri.012G096500 43 / 1e-05 AT5G63440 442 / 5e-160 Protein of unknown function (DUF167) (.1), Protein of unknown function (DUF167) (.2), Protein of unknown function (DUF167) (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02594 DUF167 Uncharacterised ACR, YggU family COG1872
Representative CDS sequence
>Lus10033521 pacid=23143383 polypeptide=Lus10033521 locus=Lus10033521.g ID=Lus10033521.BGIv1.0 annot-version=v1.0
ATGGCTCCGTCGAGCAAGAAAGGTAAAGGAAAGGCAAATTCAGCTCCGTTACAAAAATCAGAAACGAAACCTTCTTCCGATTTCCCGTCTTTTATTCGAT
CGGTACCTCCGTCGTCAGTGGCCATCACCATCCACGCGAAGCCCGGCGCTAAATCGGCATCCATTACAGATTTCAGTGACGAGGCTTTAGGAGTGCAGAT
CGACGCCCCTGCCAAGGACGGTGAAGCCAACGCAGCTCTCCATGTTCATGAGTCCCCTTTCGAACAGGTATTAGGGGTGAAAAGAAGGCAGGTGTCGCTC
GGGGCAGGCTCGAAATCAAGAGACAAGGTGGTTATAGTGGAGGAATTAACCCTACAAGATGTCTTCAGTGCTTTAAAGAAGTCTCAGATGTGA
AA sequence
>Lus10033521 pacid=23143383 polypeptide=Lus10033521 locus=Lus10033521.g ID=Lus10033521.BGIv1.0 annot-version=v1.0
MAPSSKKGKGKANSAPLQKSETKPSSDFPSFIRSVPPSSVAITIHAKPGAKSASITDFSDEALGVQIDAPAKDGEANAALHVHESPFEQVLGVKRRQVSL
GAGSKSRDKVVIVEELTLQDVFSALKKSQM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G49170 Protein of unknown function (D... Lus10033521 0 1
AT3G03140 Tudor/PWWP/MBT superfamily pro... Lus10013363 16.7 0.7836

Lus10033521 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.