Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18715 49 / 4e-09 IDL4 inflorescence deficient in abscission (IDA)-like 4 (.1) AT5G64667 43 / 1e-06 IDL2 inflorescence deficient in abscission (IDA)-like 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020848 [exp] 110 / 4e-33 AT3G18715 53 / 1e-10 inflorescence deficient in abscission (IDA)-like 4 (.1) Lus10005811 [exp] 68 / 3e-16 AT5G64667 63 / 2e-14 inflorescence deficient in abscission (IDA)-like 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G110700 [exp] 65 / 3e-15 AT5G64667 53 / 1e-10 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.005G057400 [exp] 63 / 1e-14 AT5G64667 59 / 5e-13 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.005G189900 [exp] 39 / 2e-05 AT5G64667 47 / 1e-08 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.002G070401 [exp] 38 / 0.0001 AT5G64667 44 / 4e-07 inflorescence deficient in abscission (IDA)-like 2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033523 pacid=23143264 polypeptide=Lus10033523 locus=Lus10033523.g ID=Lus10033523.BGIv1.0 annot-version=v1.0 ATGGTGGTCCAAGTCCAATTCTGCAGAAACCACCGACAACCCAGATCATCAAATTTCTGCATGATCATCGTCATCTTGTTGTTGCTAGTGGGGAGAAGCC ATGGATCGAGACCAAGCTCAAGCACTAGTACTGTCTTCAGGGTGAAGCCGACAACAGAAGATTACTACTACTACAGAGGCCATTTCACTGATTTCCTCCC AAGGCATTTGCACCTCATCCCAACTTCTGGGCCTTCCAGGAGACACAATGACATTGGATTGCAAGCTTGGGGGTCGCCATGA
AA sequence Show only first row Show all	>Lus10033523 pacid=23143264 polypeptide=Lus10033523 locus=Lus10033523.g ID=Lus10033523.BGIv1.0 annot-version=v1.0 MVVQVQFCRNHRQPRSSNFCMIIVILLLLVGRSHGSRPSSSTSTVFRVKPTTEDYYYYRGHFTDFLPRHLHLIPTSGPSRRHNDIGLQAWGSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18715		IDL4	inflorescence deficient in abs...		Lus10033523 [exp]	0	1
AT4G21870			HSP20-like chaperones superfam...		Lus10018346 [exp]	2.0	0.8054
AT1G09790		COBL6	COBRA-like protein 6 precursor...		Lus10010097 [exp]	5.3	0.8231
AT3G59510			Leucine-rich repeat (LRR) fami...		Lus10007417 [exp]	7.7	0.7178
AT4G37220			Cold acclimation protein WCOR4...		Lus10027945 [exp]	7.7	0.8016
AT3G52740			unknown protein		Lus10022717 [exp]	8.0	0.7917
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10029090 [exp]	11.5	0.6536
AT1G20925			Auxin efflux carrier family pr...		Lus10030715 [exp]	12.1	0.7736
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10004251 [exp]	12.5	0.7421
AT5G07990		CYP75B1, D501, ...	TRANSPARENT TESTA 7, CYTOCHROM...		Lus10040526 [exp]	13.2	0.7821
AT5G07990		CYP75B1, D501, ...	TRANSPARENT TESTA 7, CYTOCHROM...		Lus10040525 [exp]	13.3	0.7653

Compare expression of checked genes

Lus10033523 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.