Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09890 70 / 2e-17 Protein of unknown function (DUF3511) (.1) AT5G11970 56 / 7e-12 Protein of unknown function (DUF3511) (.1) AT2G19460 52 / 3e-10 Protein of unknown function (DUF3511) (.1) AT2G47480 51 / 9e-10 Protein of unknown function (DUF3511) (.1) AT3G05725 51 / 1e-09 Protein of unknown function (DUF3511) (.1) AT3G13910 49 / 3e-09 Protein of unknown function (DUF3511) (.1) AT1G72720 48 / 2e-08 Protein of unknown function (DUF3511) (.1) AT3G62640 43 / 1e-06 Protein of unknown function (DUF3511) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020842 [exp] 134 / 5e-42 AT4G09890 69 / 2e-16 Protein of unknown function (DUF3511) (.1) Lus10006799 [exp] 113 / 1e-34 AT4G09890 70 / 2e-17 Protein of unknown function (DUF3511) (.1) Lus10005802 [exp] 113 / 1e-34 AT4G09890 71 / 1e-17 Protein of unknown function (DUF3511) (.1) Lus10028734 [exp] 73 / 1e-18 AT4G09890 69 / 8e-17 Protein of unknown function (DUF3511) (.1) Lus10028690 [exp] 66 / 9e-16 AT4G09890 71 / 1e-17 Protein of unknown function (DUF3511) (.1) Lus10011939 [exp] 56 / 2e-11 AT2G19460 109 / 6e-32 Protein of unknown function (DUF3511) (.1) Lus10027629 [exp] 56 / 2e-11 AT2G19460 110 / 2e-32 Protein of unknown function (DUF3511) (.1) Lus10008471 [exp] 52 / 4e-10 AT2G19460 95 / 1e-26 Protein of unknown function (DUF3511) (.1) Lus10031405 [exp] 52 / 7e-10 AT3G05725 71 / 6e-17 Protein of unknown function (DUF3511) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G077500 [exp] 94 / 6e-27 AT4G09890 80 / 3e-21 Protein of unknown function (DUF3511) (.1) Potri.002G065200 [exp] 89 / 6e-25 AT4G09890 84 / 9e-23 Protein of unknown function (DUF3511) (.1) Potri.005G195800 [exp] 86 / 7e-24 AT4G09890 81 / 1e-21 Protein of unknown function (DUF3511) (.1) Potri.001G197700 [exp] 59 / 8e-13 AT2G19460 78 / 1e-19 Protein of unknown function (DUF3511) (.1) Potri.006G147700 [exp] 54 / 1e-10 AT2G19460 96 / 2e-26 Protein of unknown function (DUF3511) (.1) Potri.014G123600 [exp] 53 / 2e-10 AT2G47480 93 / 5e-26 Protein of unknown function (DUF3511) (.1) Potri.003G043600 [exp] 53 / 2e-10 AT5G11970 89 / 5e-24 Protein of unknown function (DUF3511) (.1) Potri.006G225900 [exp] 52 / 6e-10 AT5G11970 90 / 2e-24 Protein of unknown function (DUF3511) (.1) Potri.005G019900 [exp] 50 / 1e-09 AT3G05725 63 / 3e-14 Protein of unknown function (DUF3511) (.1) Potri.013G010600 [exp] 50 / 2e-09 AT2G47480 54 / 5e-11 Protein of unknown function (DUF3511) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12023 [flax] [poplar] DUF3511 Domain of unknown function (DUF3511)
Representative CDS sequence Show only first row Show all	>Lus10033529 pacid=23143546 polypeptide=Lus10033529 locus=Lus10033529.g ID=Lus10033529.BGIv1.0 annot-version=v1.0 ATGGAGAAAAGCAAATCATTTGCAGGTTACTCAGCAATGAGGAGGGTGGATTACCTGGAGGACAAGTCGAAATCGTACAGCTTCAACGGAAAAGACGGTG GTGAATCTTGGAGTGAGAATCCAGAGCTCGAAAGGAAGAAGAGGGTGGCTCAGTACAACGTCTACTCCGTCGAAGGTAAGCTCAAATCATCTCTCAGAAA CAGCTTAAAGTGGATCAAGAGCAAGTTCGTTGAGGACCACTTCCAAGATCGAAGCTGTTAA
AA sequence Show only first row Show all	>Lus10033529 pacid=23143546 polypeptide=Lus10033529 locus=Lus10033529.g ID=Lus10033529.BGIv1.0 annot-version=v1.0 MEKSKSFAGYSAMRRVDYLEDKSKSYSFNGKDGGESWSENPELERKKRVAQYNVYSVEGKLKSSLRNSLKWIKSKFVEDHFQDRSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G09890			Protein of unknown function (D...		Lus10033529 [exp]	0	1
AT3G19200			unknown protein		Lus10014046 [exp]	1.7	0.9016
AT5G63180			Pectin lyase-like superfamily ...		Lus10014887 [exp]	1.7	0.8916
AT1G31770		ABCG14	ATP-binding cassette G14, ATP-...		Lus10034775 [exp]	2.6	0.8803
AT2G39510			nodulin MtN21 /EamA-like trans...		Lus10005964 [exp]	3.3	0.8709
AT2G27550		ATC	centroradialis (.1)		Lus10043385 [exp]	4.2	0.8830
AT5G05970		NEDD1	NEURAL PRECURSOR CELL EXPRESSE...		Lus10040260 [exp]	4.5	0.8872
AT4G09890			Protein of unknown function (D...		Lus10020842 [exp]	7.1	0.8978
AT3G26590			MATE efflux family protein (.1...		Lus10006206 [exp]	8.1	0.8147
AT5G67265			unknown protein		Lus10042633 [exp]	9.5	0.8688
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10025409 [exp]	15.8	0.8865

Compare expression of checked genes

Lus10033529 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.