Lus10033541 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G04560 52 / 2e-08 AWPM-19-like family protein (.1)
AT1G29520 50 / 4e-08 AWPM-19-like family protein (.1)
AT5G46530 43 / 1e-05 AWPM-19-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017578 104 / 8e-29 AT1G04560 148 / 1e-45 AWPM-19-like family protein (.1)
Lus10014456 48 / 4e-07 AT1G04560 254 / 2e-87 AWPM-19-like family protein (.1)
Lus10023713 48 / 5e-07 AT1G04560 254 / 2e-87 AWPM-19-like family protein (.1)
Lus10025374 45 / 4e-06 AT5G46530 241 / 4e-83 AWPM-19-like family protein (.1)
Lus10015255 44 / 9e-06 AT5G46530 240 / 2e-82 AWPM-19-like family protein (.1)
Lus10004587 40 / 0.0002 AT5G46530 240 / 2e-82 AWPM-19-like family protein (.1)
Lus10011973 39 / 0.0004 AT5G46530 240 / 2e-82 AWPM-19-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G113000 70 / 2e-15 AT1G04560 155 / 2e-48 AWPM-19-like family protein (.1)
Potri.001G354500 48 / 3e-07 AT1G29520 194 / 3e-64 AWPM-19-like family protein (.1)
Potri.010G064200 45 / 3e-06 AT1G04560 214 / 2e-71 AWPM-19-like family protein (.1)
Potri.011G077800 39 / 0.0004 AT5G46530 164 / 2e-52 AWPM-19-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05512 AWPM-19 AWPM-19-like family
Representative CDS sequence
>Lus10033541 pacid=23143543 polypeptide=Lus10033541 locus=Lus10033541.g ID=Lus10033541.BGIv1.0 annot-version=v1.0
ATGGGGAGGGGGTTGATGTGTCCTATGTTAATAGTGAACTTGGTGGTTGTCTTCATCGTACTTGGTCTTGCCGCTTGGTCCCTTGACAAATACATCGACG
GCCAACAGAATCAACCCCCGGAATTTCCTGAAATTCCCTTGTTGTACGTGTCAAATACAGATATGGGAGGGAATGAGTCCACAATCTTCATGCTGGTCTA
TGCGCTGATTGCTGGTGCAGTCGGTGCCGCCTCGACGCTGTTTGGGTTCATCCACCTTCGGTCATGGACGAGTCAGAGTTTGGCCTCTGCCGCTTCTTTG
GCGCTCGTCTCTTGGTCTCTTGCTGCTCTCTCTTCTGGTGGTGTTTGGCGGCATTGCCGTCTCACGGTTAATATGGTTGTGCATGTTACGGCTCAGTTAT
GGCTCATAGTACTGCCAATTGGAATTGTCCGATCGTTTGGGTCGATCAACTCTTATTTTTCTGGTTGTCAAGTTCAAAATGGATGA
AA sequence
>Lus10033541 pacid=23143543 polypeptide=Lus10033541 locus=Lus10033541.g ID=Lus10033541.BGIv1.0 annot-version=v1.0
MGRGLMCPMLIVNLVVVFIVLGLAAWSLDKYIDGQQNQPPEFPEIPLLYVSNTDMGGNESTIFMLVYALIAGAVGAASTLFGFIHLRSWTSQSLASAASL
ALVSWSLAALSSGGVWRHCRLTVNMVVHVTAQLWLIVLPIGIVRSFGSINSYFSGCQVQNG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G04560 AWPM-19-like family protein (.... Lus10033541 0 1
AT5G36930 Disease resistance protein (TI... Lus10026707 2.4 0.7271
Lus10027601 3.5 0.7326
Lus10028008 6.6 0.5901
Lus10012677 8.5 0.7255
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10029812 8.9 0.6754
Lus10014737 10.8 0.6868
AT3G04060 NAC ANAC046 NAC domain containing protein ... Lus10033699 12.0 0.6868
AT1G04520 PDLP2 plasmodesmata-located protein ... Lus10028049 13.2 0.6868
AT4G16195 Plant self-incompatibility pro... Lus10019768 14.2 0.6868
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10033877 14.9 0.6855

Lus10033541 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.