Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16060 107 / 1e-32 Cytochrome c oxidase biogenesis protein Cmc1-like (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017586 [exp] 137 / 3e-44 AT5G16060 134 / 9e-43 Cytochrome c oxidase biogenesis protein Cmc1-like (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G113401 [exp] 123 / 1e-38 AT5G16060 139 / 2e-44 Cytochrome c oxidase biogenesis protein Cmc1-like (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0351 [flax] [poplar] CHCH PF08583 [flax] [poplar] Cmc1 Cytochrome c oxidase biogenesis protein Cmc1 like
Representative CDS sequence Show only first row Show all	>Lus10033547 pacid=23143329 polypeptide=Lus10033547 locus=Lus10033547.g ID=Lus10033547.BGIv1.0 annot-version=v1.0 ATGGGTTACCTTCAGGAAGCTCGTGAGAATCACGTAAAGAAGAAGGTCGAGGAAGCTTTGATCAGTAAAATGAAGCACAAGGCACTGAAAGAATGTGAAC ATCTCGCTTCACAGTACGCACAATGTGCTACCGGAAGAACACTTTCCGTTGTGTGGCAGTGTCGGAAACAAGCCAAGGAGCTGAATTCCTGCCTGCATCA GTTGTAA
AA sequence Show only first row Show all	>Lus10033547 pacid=23143329 polypeptide=Lus10033547 locus=Lus10033547.g ID=Lus10033547.BGIv1.0 annot-version=v1.0 MGYLQEARENHVKKKVEEALISKMKHKALKECEHLASQYAQCATGRTLSVVWQCRKQAKELNSCLHQL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G16060			Cytochrome c oxidase biogenesi...		Lus10033547 [exp]	0	1
AT5G16060			Cytochrome c oxidase biogenesi...		Lus10017586 [exp]	1.7	0.8627
AT1G65650		UCH2	Peptidase C12, ubiquitin carbo...		Lus10042047 [exp]	2.0	0.8656
AT4G29390			Ribosomal protein S30 family p...		Lus10002508 [exp]	4.0	0.8403
AT3G18760			Translation elongation factor...		Lus10006729 [exp]	6.0	0.8653
AT2G40390			unknown protein		Lus10017423 [exp]	8.2	0.7976
AT5G41010		NRPE12, NRPD12,...	DNA directed RNA polymerase, 7...		Lus10030353 [exp]	8.5	0.8092
AT1G51650			ATP synthase epsilon chain, mi...		Lus10034841 [exp]	9.2	0.7843
AT1G76860			Small nuclear ribonucleoprotei...		Lus10011293 [exp]	10.2	0.8350
AT5G13340			unknown protein		Lus10035960 [exp]	12.2	0.8358
AT3G07020		UGT80A2, SGT	UDP-glucosyl transferase 80A2,...		Lus10022815 [exp]	13.4	0.8171

Compare expression of checked genes

Lus10033547 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.