Lus10033550 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02280 122 / 4e-33 Flavodoxin family protein (.1)
AT3G24710 69 / 1e-16 unknown protein
AT4G24520 66 / 1e-13 AR1, ATR1 ARABIDOPSIS CYTOCHROME REDUCTASE, P450 reductase 1 (.1.2)
AT4G30210 62 / 3e-12 AR2, ATR2 P450 reductase 2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017589 195 / 4e-60 AT3G02280 810 / 0.0 Flavodoxin family protein (.1)
Lus10019996 69 / 2e-14 AT4G30210 1013 / 0.0 P450 reductase 2 (.1.2)
Lus10015525 69 / 2e-14 AT4G30210 1009 / 0.0 P450 reductase 2 (.1.2)
Lus10006972 66 / 2e-13 AT4G30210 983 / 0.0 P450 reductase 2 (.1.2)
Lus10025485 66 / 2e-13 AT4G30210 681 / 0.0 P450 reductase 2 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G101100 140 / 7e-40 AT3G02280 811 / 0.0 Flavodoxin family protein (.1)
Potri.011G027100 110 / 4e-32 AT3G02280 144 / 2e-41 Flavodoxin family protein (.1)
Potri.002G106566 67 / 5e-14 AT4G24520 459 / 2e-159 ARABIDOPSIS CYTOCHROME REDUCTASE, P450 reductase 1 (.1.2)
Potri.018G092100 67 / 1e-13 AT4G30210 984 / 0.0 P450 reductase 2 (.1.2)
Potri.005G153800 66 / 1e-13 AT4G24520 974 / 0.0 ARABIDOPSIS CYTOCHROME REDUCTASE, P450 reductase 1 (.1.2)
Potri.006G167200 66 / 3e-13 AT4G30210 965 / 0.0 P450 reductase 2 (.1.2)
PFAM info
Representative CDS sequence
>Lus10033550 pacid=23143279 polypeptide=Lus10033550 locus=Lus10033550.g ID=Lus10033550.BGIv1.0 annot-version=v1.0
ATGACTGATGATGATGATGATAGGTATGATTATGATCCTGCTGAGTTCTACCATTGTCCTACTCCCCTTATTTTTACAGGGGGACTTGTGGCTGTCCCAG
AACCGGACGATGGATTGCTTTCAGAAGTGAGAGGCGGAGGCTTCTACGTTGCGTTTTCGAGAGACCAGGATCGGAAGGTTTACGTGCAGCACAAGATGTT
GGAACAGAGCAGGATGATATGGAAGATGGTTTCGGAAGGTGGTGCTGCAGTGTATGTAGCTGGCTCCTCGACGAAAATGCCGTCTGATGTGATGTCGGCT
GTGGAAGAGATCATGGCGAGAGAGGGTGGAGTGCCGAAAGAGACGGCTGCAACGGTGATGAGGAGGTTGGAGAGAGATGGTAAATACCGTGTTGAAGCAT
GGTCTTGA
AA sequence
>Lus10033550 pacid=23143279 polypeptide=Lus10033550 locus=Lus10033550.g ID=Lus10033550.BGIv1.0 annot-version=v1.0
MTDDDDDRYDYDPAEFYHCPTPLIFTGGLVAVPEPDDGLLSEVRGGGFYVAFSRDQDRKVYVQHKMLEQSRMIWKMVSEGGAAVYVAGSSTKMPSDVMSA
VEEIMAREGGVPKETAATVMRRLERDGKYRVEAWS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G02280 Flavodoxin family protein (.1) Lus10033550 0 1
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10019784 1.0 0.6555
AT5G02930 F-box/RNI-like superfamily pro... Lus10040452 11.2 0.6373
Lus10036275 18.7 0.6010
AT4G19810 ChiC class V chitinase, Glycosyl hy... Lus10000981 22.4 0.5784
AT3G25900 HMT-1, ATHMT-1 Homocysteine S-methyltransfera... Lus10034320 26.1 0.5590
AT2G39770 VTC1, SOZ1, GMP... VITAMIN C DEFECTIVE 1, SENSITI... Lus10028418 26.8 0.5764
AT3G08710 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredo... Lus10030505 35.0 0.5718
AT2G26390 Serine protease inhibitor (SER... Lus10039336 37.3 0.5656
Lus10022857 41.2 0.5299
Lus10029472 43.0 0.5414

Lus10033550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.