Lus10033552 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G13340 206 / 4e-63 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G35730 139 / 5e-37 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G34220 132 / 3e-34 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G25420 126 / 1e-33 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
AT2G19710 123 / 9e-31 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G29440 115 / 5e-28 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G79910 106 / 1e-25 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G14830 102 / 5e-24 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G52315 100 / 7e-24 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G32350 92 / 3e-20 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017591 357 / 2e-124 AT1G13340 158 / 3e-46 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10041468 238 / 4e-75 AT1G13340 239 / 1e-74 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10034303 231 / 3e-72 AT1G13340 243 / 5e-76 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10017592 204 / 5e-63 AT1G13340 178 / 3e-52 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10033553 142 / 4e-39 AT1G13340 107 / 6e-26 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10041836 137 / 2e-36 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10000978 138 / 7e-36 AT2G19710 308 / 6e-89 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10028383 133 / 5e-35 AT4G35730 415 / 2e-142 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10006061 132 / 1e-34 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G127000 241 / 5e-76 AT1G13340 268 / 1e-85 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.017G113900 235 / 6e-76 AT1G13340 211 / 9e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.004G100900 236 / 1e-72 AT1G13340 223 / 1e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.006G149800 143 / 1e-37 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.007G059800 136 / 4e-36 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.019G087400 135 / 2e-35 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.013G117100 133 / 2e-34 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.008G121300 129 / 2e-34 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Potri.004G038600 103 / 3e-24 AT2G14830 175 / 3e-48 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.011G122800 97 / 4e-22 AT2G14830 137 / 5e-36 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence
>Lus10033552 pacid=23143304 polypeptide=Lus10033552 locus=Lus10033552.g ID=Lus10033552.BGIv1.0 annot-version=v1.0
ATGGGTAGGAAGCTGGATGCTCTTCTAGGAAGAAACTTCAGAGCATCCAAGTTCAAGGCTTTATCCACCGTTGCAATCTCAAGGATCGTCATTCTCAAAA
GGCAGAGGTTTTCCAGGTTTTCCCAGGCAAAGTCTGATGTTATTGAACTCCTCAATCTTGACCAGCACGACAGAGCTCTCATTCGCGTTGAGCTTGTGGT
CAAGGATCGTCTTATGCTTGATGCATTCGACATGATTCGAAGCTACTGCGAGTTGCTGAAAGAAAGTGTCTTGCTTCTCCAAAAGACCAAAGAATGCCCA
GATGAGCTTAAGGAGTCAATCTCAAGCTTGATCTTTGCGTCGTCAAGGTGTGCAGAGTTCCCTGAGCTCCAAGAGATGCGCGCGGTTTTCCAAGTGCGAT
TCGGGAAGGAGTTTGTTGCTCGCGCCATCGAGCTGCGAAACAATTGTGCTGTGAATCCCAAGATCATCCAGAAATTATCAGCAAGACAGCCGAGTTTAGA
AAGCAGGATTGAAGTGCTGAGAAGCATTGCCTCTGAGGTTAATATCATCCTAGATTTGAAACTTCATGTTCAACCGCAGAAACCTGATGTGTCTCGAAAG
CAAGAACCTGAGGAGTCAGATGCATGGTTGGAGGACAGTGCTCATAAAGCTGAGGCTGCTCAATCGCAATCTTCAGATTCAGATGAAGAGTTCTCTGAGT
CGCTGAAAGCAAAAAACAAGTATAGAGATGCAGCTGCTGCTGCCAAGGAAGCTTTTCAATCAGCAGCTTATGCAGCCATGGCTGCTAGAGCTGCACTCAA
GCTTTCAAGATCCGAATCCAACCATGGTGGTTCAGGACATCATGGAGGAACCATGGACAACCAAATCATTGTTTACGAGGCCTATCCGGAAGAAGAAGAA
GAAAGCCACCAGCTACAGAGAGACACTCCAGCAGAGCCCGACCAACAGAAATGGGAACACAAGCATATCGGAGATGGCTTTGCTGCTACAGATGTAAATA
CCCTCAACTGGAATCAGCTTACAGTTTCTTCTGGAGGCAAGTAG
AA sequence
>Lus10033552 pacid=23143304 polypeptide=Lus10033552 locus=Lus10033552.g ID=Lus10033552.BGIv1.0 annot-version=v1.0
MGRKLDALLGRNFRASKFKALSTVAISRIVILKRQRFSRFSQAKSDVIELLNLDQHDRALIRVELVVKDRLMLDAFDMIRSYCELLKESVLLLQKTKECP
DELKESISSLIFASSRCAEFPELQEMRAVFQVRFGKEFVARAIELRNNCAVNPKIIQKLSARQPSLESRIEVLRSIASEVNIILDLKLHVQPQKPDVSRK
QEPEESDAWLEDSAHKAEAAQSQSSDSDEEFSESLKAKNKYRDAAAAAKEAFQSAAYAAMAARAALKLSRSESNHGGSGHHGGTMDNQIIVYEAYPEEEE
ESHQLQRDTPAEPDQQKWEHKHIGDGFAATDVNTLNWNQLTVSSGGK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G13340 Regulator of Vps4 activity in ... Lus10033552 0 1
AT1G60690 NAD(P)-linked oxidoreductase s... Lus10023701 2.4 0.9863
AT4G11410 NAD(P)-binding Rossmann-fold s... Lus10031100 3.2 0.9869
Lus10015339 3.9 0.9847
AT5G45860 RCAR5, PYL11 regulatory components of ABA r... Lus10003187 4.9 0.9849
AT3G51680 AtSDR2 short-chain dehydrogenase/redu... Lus10016995 8.1 0.9827
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10028898 8.8 0.9860
AT1G63970 MECPS, ISPF 2C-METHYL-D-ERYTHRITOL 2,4-CYC... Lus10028759 12.4 0.9839
AT2G39120 WTF9 what's this factor 9, Ubiquiti... Lus10038710 15.3 0.9460
AT3G52970 CYP76G1 "cytochrome P450, family 76, s... Lus10021137 15.9 0.9843
AT1G11340 S-locus lectin protein kinase ... Lus10030767 16.2 0.9602

Lus10033552 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.