Lus10033553 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G13340 106 / 2e-25 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G25420 99 / 9e-24 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
AT4G35730 98 / 2e-22 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G34220 98 / 3e-22 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G19710 92 / 7e-20 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G29440 84 / 2e-17 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G79910 67 / 5e-12 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G14830 64 / 4e-11 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G52315 58 / 3e-09 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT3G15490 54 / 3e-08 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017592 402 / 7e-140 AT1G13340 178 / 3e-52 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10033552 142 / 4e-39 AT1G13340 208 / 6e-64 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10041468 143 / 1e-38 AT1G13340 239 / 1e-74 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10034303 139 / 3e-37 AT1G13340 243 / 5e-76 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10017591 103 / 2e-25 AT1G13340 158 / 3e-46 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10041442 98 / 5e-23 AT1G25420 270 / 6e-90 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Lus10041836 99 / 1e-22 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10028724 97 / 7e-22 AT1G34220 417 / 1e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10006061 96 / 2e-21 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G113900 139 / 1e-38 AT1G13340 211 / 9e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.010G127000 141 / 7e-38 AT1G13340 268 / 1e-85 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.004G100900 140 / 1e-36 AT1G13340 223 / 1e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.019G087400 103 / 3e-24 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.008G121300 101 / 3e-24 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Potri.013G117100 99 / 1e-22 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.006G149800 99 / 3e-22 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.007G059800 97 / 4e-22 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.004G038600 73 / 8e-14 AT2G14830 175 / 3e-48 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.013G135700 71 / 5e-13 AT2G14830 228 / 2e-67 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence
>Lus10033553 pacid=23143520 polypeptide=Lus10033553 locus=Lus10033553.g ID=Lus10033553.BGIv1.0 annot-version=v1.0
ATGCGTGCACGTCGTATAATCTTGAAGAACTCTAAAATTAAATGTGTTCAATGTAAAGTGGTGTTAATTGAGATGAATAATCTTGTTACAATCCAAAAGA
AGTTAGTACCGTGTCACAACAAGACCTGGAATTTCTGGTCTAGTGATTCACCGGCGATGTGGATCTTTGGTCTTAGGTACCGCTCAAGTCTTCTCGCATT
TCATGGATCTACTGTTACTGGAATTTCCGGCCATTCGTCAAGCTTTTTTGGTGGCTCGAGGAGCAGAACTATGTTGGATTCCTATGCCATGATCGACAAC
TACTGCCATCTCCTCAGAGAAAGGCTCGTCGTCATCGAGACCAATTATTCCAAGGAATGCCCAGATGAGCTGAAGGAGGCAATAGCAAGTTTGATCTTTG
CGGCGGCAAGGTGTGGGGAATTGCCGGAGTTGCAAGAGATGAAGAGGCTATTCACTTGTAGATACGGCAAGGAATTCACCACTGGCGCCGCTGAAATGCG
GAATAACTGTGGAGTCCACCCTAGGATTGCGAAGAAGCTGTCGACCAAGCAACCAAGCCTGGAAAGCAAAATCATTGCGCTAAAGGAAATAGCTCCAAAG
TGTGAACTCATCCCGCACTTAGATGAAGTGGCCTTTTCACTCCCCAAATCACCACCTGCTAGCAGTCATAATTCTCAACATCATCACGCCATTGTGGTCG
ACGAGACGAACATGCACGACTCCGCTGCATCATCTGCACGGTTTGTTCGGACGCCATCGAGGAGCTACTCCGAGAGGTACCCGAACTTCGAGGCTGCAGT
CCACGCTGCCTGTGAGCTGTCAGCTCAGGCCGCGGCTGCAGCCAGAGCTGCCATGGAGCTCTCCTCTAGGCCACCCACTGACGGCGGTGATTCGAGTTCG
GATAGGAATAATGGTGTTAGTTCAGTATTGAAGTTACTGAGGAGGAGCAATACTACTTGTGTAGCTGCAGATGGTTTTGATGGCGCCAATGGGATATCTA
GGGTTGTTGTGGCATCATCATCGGACTATGTTCCCAAGTTGTTCAAGAGAAGTTCTAGTGCCGTTACGACATTGTTCGATCTTCACCCTCCGAATATTGG
AAGGTGA
AA sequence
>Lus10033553 pacid=23143520 polypeptide=Lus10033553 locus=Lus10033553.g ID=Lus10033553.BGIv1.0 annot-version=v1.0
MRARRIILKNSKIKCVQCKVVLIEMNNLVTIQKKLVPCHNKTWNFWSSDSPAMWIFGLRYRSSLLAFHGSTVTGISGHSSSFFGGSRSRTMLDSYAMIDN
YCHLLRERLVVIETNYSKECPDELKEAIASLIFAAARCGELPELQEMKRLFTCRYGKEFTTGAAEMRNNCGVHPRIAKKLSTKQPSLESKIIALKEIAPK
CELIPHLDEVAFSLPKSPPASSHNSQHHHAIVVDETNMHDSAASSARFVRTPSRSYSERYPNFEAAVHAACELSAQAAAAARAAMELSSRPPTDGGDSSS
DRNNGVSSVLKLLRRSNTTCVAADGFDGANGISRVVVASSSDYVPKLFKRSSSAVTTLFDLHPPNIGR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G13340 Regulator of Vps4 activity in ... Lus10033553 0 1
AT3G44830 Lecithin:cholesterol acyltrans... Lus10019519 11.6 0.8061
AT3G63480 ATP binding microtubule motor ... Lus10035343 13.2 0.8368
AT3G19210 ATRAD54, CHR25 homolog of RAD54 (.1.2) Lus10014047 22.3 0.8145
AT5G10530 Concanavalin A-like lectin pro... Lus10007077 22.6 0.8019
AT4G02900 ERD (early-responsive to dehyd... Lus10000660 25.0 0.7676
AT5G11320 YUC4 YUCCA4, Flavin-binding monooxy... Lus10013125 27.7 0.8143
AT2G42840 PDF1 protodermal factor 1 (.1) Lus10007352 31.6 0.8067
AT4G36920 AP2_ERF FL1, FLO2, AP2 FLORAL MUTANT 2, FLOWER 1, APE... Lus10023165 42.0 0.7895
AT3G26660 AS2 LBD24 LOB domain-containing protein ... Lus10009567 45.6 0.7995
AT1G03440 Leucine-rich repeat (LRR) fami... Lus10031601 48.0 0.7559

Lus10033553 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.