Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38195 91 / 4e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G18280 89 / 2e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G66850 85 / 9e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38160 82 / 2e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G48750 81 / 4e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G14846 79 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38180 77 / 1e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73780 77 / 2e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G43667 76 / 2e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38197 75 / 8e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017615 [exp] 155 / 1e-50 AT5G38195 91 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033574 [exp] 84 / 2e-22 AT3G18280 97 / 8e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017616 [exp] 84 / 6e-22 AT3G18280 100 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10029131 [exp] 61 / 3e-13 AT3G18280 108 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10013030 [exp] 60 / 6e-13 AT3G18280 109 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042449 [exp] 40 / 0.0002 AT1G55260 160 / 3e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G118700 [exp] 83 / 3e-22 AT3G18280 87 / 5e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G044500 [exp] 82 / 2e-21 AT3G18280 109 / 8e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.012G054300 [exp] 74 / 1e-18 AT3G18280 103 / 3e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G096000 [exp] 69 / 1e-16 AT3G18280 82 / 6e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033573 pacid=23143277 polypeptide=Lus10033573 locus=Lus10033573.g ID=Lus10033573.BGIv1.0 annot-version=v1.0 ATGAAGCTTCTTTTGTCTCTCTTCCTTGCGGCGGCGGTTATGGCGGTGGTCATCACGAGTGAAGCAGAGGGTGTGGCGGCGGCGGCGGCTGACTGCACCC CGACGGACCTCCTCCCATGCCTGCCGGCGATAACGTCGGGGGCGGCCCCGACGAAAGAATGCTGCGGGAAGCTGAAGGACCAGGAGGATTGCCTGTGTAG GTACTCGAAGAATCCGGATTTTGGGAAATATGTCTCTTCTCCTAACGCCAAAAAGGTTATCGACGCCTGTGATGTTCCTCACCCTTCTTGTACCTCTAAT AAATTACATAGTGTAGAGGAGGAGCAACAATGA
AA sequence Show only first row Show all	>Lus10033573 pacid=23143277 polypeptide=Lus10033573 locus=Lus10033573.g ID=Lus10033573.BGIv1.0 annot-version=v1.0 MKLLLSLFLAAAVMAVVITSEAEGVAAAAADCTPTDLLPCLPAITSGAAPTKECCGKLKDQEDCLCRYSKNPDFGKYVSSPNAKKVIDACDVPHPSCTSN KLHSVEEEQQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G38195			Bifunctional inhibitor/lipid-t...		Lus10033573 [exp]	0	1
AT4G15620			Uncharacterised protein family...		Lus10031998 [exp]	1.4	0.8994
AT2G01570	GRAS	RGA1	REPRESSOR OF GA1-3 1, REPRESSO...		Lus10018101 [exp]	6.0	0.7911
AT5G38760			Late embryogenesis abundant pr...		Lus10034100 [exp]	7.1	0.7580
AT3G49400			Transducin/WD40 repeat-like su...		Lus10008595 [exp]	10.8	0.8292
					Lus10024122 [exp]	11.6	0.7919
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10017925 [exp]	12.7	0.7787
					Lus10000543 [exp]	18.8	0.7109
AT3G01270			Pectate lyase family protein (...		Lus10037207 [exp]	19.8	0.7497
AT1G68800	TCP	TCP12, BRC2, TC...	BRANCHED 2, TCP domain protein...		Lus10035055 [exp]	20.0	0.7768
AT3G01570			Oleosin family protein (.1)		Lus10028035 [exp]	20.5	0.6084

Compare expression of checked genes

Lus10033573 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.