Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G48750 91 / 3e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G18280 89 / 2e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38160 85 / 9e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38170 81 / 5e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38195 77 / 7e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G66850 77 / 7e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73780 71 / 3e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G14846 70 / 8e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G43666 69 / 1e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G57310 66 / 2e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017616 [exp] 127 / 4e-39 AT3G18280 100 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017615 [exp] 80 / 1e-20 AT5G38195 91 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033573 [exp] 79 / 2e-20 AT5G38195 92 / 9e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10013030 [exp] 70 / 9e-17 AT3G18280 109 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10029131 [exp] 69 / 2e-16 AT3G18280 108 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G118700 [exp] 92 / 6e-26 AT3G18280 87 / 5e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G044500 [exp] 83 / 5e-22 AT3G18280 109 / 8e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.012G054300 [exp] 79 / 1e-20 AT3G18280 103 / 3e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G096000 [exp] 73 / 4e-18 AT3G18280 82 / 6e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10033574 pacid=23143289 polypeptide=Lus10033574 locus=Lus10033574.g ID=Lus10033574.BGIv1.0 annot-version=v1.0 ATGAAGCCGGCGGCAACAAGTTTCCTCTTCTTCGCAGCGGTGGCTATGCTGATCATCATCATGGCTGCTGGGCCCGGCGGAGCAGAGGCAGCGAGGCCAG CGGCGGATGCTACTTGCAACCCGACGGAGCTGGGCCTGTGCGCAGGGGCATTAACATCGGGAGCCCCGCCGTCAGCGGGGTGCTGCGGGAAGCTGAAACA GCAGCAGCCGTGCCTGTGTGGGTACATAAGGAACCCAAACTTCAGGCAGTTCGTAACTGCACCAGGTGCTCAACGTGTTCTCCGTTCCTGTGGCGTTGCT TACCCTTCCTGCTGA
AA sequence Show only first row Show all	>Lus10033574 pacid=23143289 polypeptide=Lus10033574 locus=Lus10033574.g ID=Lus10033574.BGIv1.0 annot-version=v1.0 MKPAATSFLFFAAVAMLIIIMAAGPGGAEAARPAADATCNPTELGLCAGALTSGAPPSAGCCGKLKQQQPCLCGYIRNPNFRQFVTAPGAQRVLRSCGVA YPSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10033574 [exp]	0	1
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10017616 [exp]	1.0	0.9662
AT1G09310			Protein of unknown function, D...		Lus10018630 [exp]	5.7	0.8347
AT5G23140		NCLPP7, NCLPP2,...	nuclear-encoded CLP protease P...		Lus10013434 [exp]	6.2	0.8792
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Lus10015631 [exp]	11.2	0.8336
AT3G09650		CRM3, HCF152	HIGH CHLOROPHYLL FLUORESCENCE ...		Lus10015059 [exp]	13.4	0.8395
AT5G23140		NCLPP7, NCLPP2,...	nuclear-encoded CLP protease P...		Lus10040981 [exp]	14.1	0.8767
AT1G11090			alpha/beta-Hydrolases superfam...		Lus10018466 [exp]	16.1	0.8530
AT4G27030		FADA, FAD4	FATTY ACID DESATURASE 4, fatty...		Lus10017089 [exp]	16.7	0.8431
AT1G11090			alpha/beta-Hydrolases superfam...		Lus10011212 [exp]	18.8	0.8478
AT5G51010			Rubredoxin-like superfamily pr...		Lus10022430 [exp]	19.1	0.7954

Compare expression of checked genes

Lus10033574 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.