Lus10033581 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G36810 119 / 1e-32 GGPS1 geranylgeranyl pyrophosphate synthase 1 (.1)
AT2G18620 110 / 1e-29 Terpenoid synthases superfamily protein (.1)
AT2G23800 104 / 5e-27 GGPS5, GGPS2 GERANYLGERANYL PYROPHOSPHATE SYNTHASE 5, geranylgeranyl pyrophosphate synthase 2 (.1)
AT2G18640 103 / 1e-26 GGPS4 geranylgeranyl pyrophosphate synthase 4 (.1)
AT3G29430 101 / 3e-26 Terpenoid synthases superfamily protein (.1)
AT3G14530 101 / 6e-26 Terpenoid synthases superfamily protein (.1)
AT3G14550 99 / 4e-25 GGPS3 geranylgeranyl pyrophosphate synthase 3 (.1)
AT3G32040 98 / 1e-24 Terpenoid synthases superfamily protein (.1)
AT3G20160 97 / 2e-24 Terpenoid synthases superfamily protein (.1)
AT1G49530 88 / 3e-21 GGPS6 geranylgeranyl pyrophosphate synthase 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017624 203 / 5e-64 AT4G36810 439 / 5e-153 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10017625 185 / 4e-58 AT4G36810 423 / 5e-148 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10028509 132 / 1e-37 AT4G36810 437 / 2e-153 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10009137 122 / 8e-36 AT4G36810 131 / 2e-37 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10028508 121 / 1e-33 AT4G36810 380 / 9e-132 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10009138 112 / 5e-30 AT4G36810 373 / 2e-128 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10028507 111 / 9e-30 AT4G36810 375 / 2e-129 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10022499 111 / 2e-29 AT4G36810 491 / 8e-175 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10016803 110 / 2e-29 AT4G36810 488 / 2e-173 geranylgeranyl pyrophosphate synthase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G090600 117 / 4e-32 AT4G36810 419 / 1e-146 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.017G124600 117 / 8e-32 AT4G36810 388 / 2e-134 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.005G127100 116 / 1e-31 AT4G36810 444 / 2e-156 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.007G031100 112 / 5e-30 AT4G36810 467 / 1e-165 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.017G124700 106 / 4e-28 AT4G36810 413 / 1e-144 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.004G179628 78 / 2e-17 AT4G38460 403 / 3e-141 geranylgeranyl reductase (.1)
Potri.009G139600 76 / 7e-17 AT4G38460 389 / 7e-136 geranylgeranyl reductase (.1)
Potri.015G043400 51 / 6e-08 AT4G38460 121 / 4e-32 geranylgeranyl reductase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0613 Terp_synthase PF00348 polyprenyl_synt Polyprenyl synthetase
Representative CDS sequence
>Lus10033581 pacid=23143260 polypeptide=Lus10033581 locus=Lus10033581.g ID=Lus10033581.BGIv1.0 annot-version=v1.0
ATGGCTTCTTCCTTCTCAATCTCATCACCAACCCCAACCATGATCTCCTCCAAAAACGTTCAACAGTCCCGATATTCCATCTTCCTCCAAAAACCCTCCA
CTCACAATCCTCTAATCTCCAACCAATCATCAGTTACCAAGTGCACATTCCCTCAATTCAACCTCCGCTCTCTTAGACTACTCCGTGCTTCTGCCTCTAC
CGCCCCTGTCGCTCCTCTGCGTCAATCTGTCGACCCAACCGTCGTCTCAGATTTCGACTTCGAGAGCTACATGGTGACGAAGGCGAACCATGTGAACAAG
GCGTTGGACAAGGCCATCCCCGTCCAGCGCCCTGTGAAAATCCACGAGGCCATGAGGTACTCCCTTCTGGCTGGAGGCAAGAGGGTCCGTCCGGTCCTTT
GTATCGCCGCTTGTGAGATGGTTGGCGGCGACGAGTCGTTGGCGATGCCTCTTTGGCGATGCCTATGGCTTGCGCCACCGAGATGA
AA sequence
>Lus10033581 pacid=23143260 polypeptide=Lus10033581 locus=Lus10033581.g ID=Lus10033581.BGIv1.0 annot-version=v1.0
MASSFSISSPTPTMISSKNVQQSRYSIFLQKPSTHNPLISNQSSVTKCTFPQFNLRSLRLLRASASTAPVAPLRQSVDPTVVSDFDFESYMVTKANHVNK
ALDKAIPVQRPVKIHEAMRYSLLAGGKRVRPVLCIAACEMVGGDESLAMPLWRCLWLAPPR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10033581 0 1
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10011986 1.0 0.9800
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10033582 1.4 0.9702
AT1G70850 MLP34 MLP-like protein 34 (.1.2.3) Lus10002644 2.8 0.9488
AT1G20870 HSP20-like chaperones superfam... Lus10007642 3.9 0.9596
Lus10008321 6.0 0.8956
AT5G51950 Glucose-methanol-choline (GMC)... Lus10015012 6.5 0.9411
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10010765 6.9 0.9048
AT1G60500 DRP4C Dynamin related protein 4C (.1... Lus10025903 7.4 0.9454
AT5G06740 Concanavalin A-like lectin pro... Lus10021060 11.6 0.9139
AT4G31970 CYP82C2, JAH1 "cytochrome P450, family 82, s... Lus10025923 13.3 0.8993

Lus10033581 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.