Lus10033582 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G36810 284 / 5e-96 GGPS1 geranylgeranyl pyrophosphate synthase 1 (.1)
AT2G18620 281 / 3e-95 Terpenoid synthases superfamily protein (.1)
AT3G14510 243 / 7e-81 Polyprenyl synthetase family protein (.1)
AT3G14530 245 / 9e-81 Terpenoid synthases superfamily protein (.1)
AT2G23800 241 / 4e-79 GGPS5, GGPS2 GERANYLGERANYL PYROPHOSPHATE SYNTHASE 5, geranylgeranyl pyrophosphate synthase 2 (.1)
AT3G14550 240 / 8e-79 GGPS3 geranylgeranyl pyrophosphate synthase 3 (.1)
AT2G18640 234 / 2e-76 GGPS4 geranylgeranyl pyrophosphate synthase 4 (.1)
AT3G20160 231 / 1e-75 Terpenoid synthases superfamily protein (.1)
AT3G29430 226 / 3e-73 Terpenoid synthases superfamily protein (.1)
AT3G32040 223 / 5e-72 Terpenoid synthases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028509 390 / 1e-137 AT4G36810 437 / 2e-153 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10017624 382 / 3e-133 AT4G36810 439 / 5e-153 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10017625 362 / 9e-127 AT4G36810 423 / 5e-148 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10028508 332 / 6e-115 AT4G36810 380 / 9e-132 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10028507 315 / 4e-108 AT4G36810 375 / 2e-129 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10009138 310 / 3e-106 AT4G36810 373 / 2e-128 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10022499 286 / 2e-96 AT4G36810 491 / 8e-175 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10016803 283 / 3e-95 AT4G36810 488 / 2e-173 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10009136 255 / 7e-88 AT2G18620 177 / 1e-55 Terpenoid synthases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G090600 331 / 1e-114 AT4G36810 419 / 1e-146 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.017G124700 311 / 7e-107 AT4G36810 413 / 1e-144 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.017G124600 295 / 2e-100 AT4G36810 388 / 2e-134 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.005G127100 290 / 2e-98 AT4G36810 444 / 2e-156 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.007G031100 289 / 6e-98 AT4G36810 467 / 1e-165 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.004G179628 154 / 2e-45 AT4G38460 403 / 3e-141 geranylgeranyl reductase (.1)
Potri.009G139600 151 / 2e-44 AT4G38460 389 / 7e-136 geranylgeranyl reductase (.1)
Potri.001G380500 101 / 5e-25 AT1G78510 597 / 0.0 solanesyl diphosphate synthase 1 (.1.2)
Potri.011G099500 69 / 2e-13 AT1G78510 415 / 8e-144 solanesyl diphosphate synthase 1 (.1.2)
Potri.011G101301 67 / 5e-13 AT1G17050 427 / 2e-148 solanesyl diphosphate synthase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0613 Terp_synthase PF00348 polyprenyl_synt Polyprenyl synthetase
Representative CDS sequence
>Lus10033582 pacid=23143400 polypeptide=Lus10033582 locus=Lus10033582.g ID=Lus10033582.BGIv1.0 annot-version=v1.0
ATGTCGTTGATTCACGACGATCTTCCATGTATGGATAACGATGACCTACGTCGTGGGAAGCCCACGAACCACAAGAAGTACGGCGAGGATACTGCTATCC
TCGCTGGCGACGCTCTGTTGTCCTTCTCGTTTGAGCATGTGGCGGTCGAGACGCCTAAGATCGTGTCGCCCGAGAGAGTTGTGAGATCGATTGCTGAGCT
GGGATCTGCTGTCGGGTCCGCGGGACTTGTTGCCGGTCAGATAGTGGACATCGCTAGTGAAGGGGAGAAAGTGAGTCTGGAAGAATTGGAGTACATCCAC
ATCCACAAAACGGCGAGGCTGTTGGAGGCGGCGGTGGTTTGTGGCGCCATCCTCGGCGGAGCCGACGAGGAGAGCGTGAAGAAGGTGAGGAAGTACTCGA
GGTGCGTGGGATTGCTGTTCCAAGTTGTGGATGATATTCTGGACGTGACAAAGTCGTCGGAGGAATTGGGAAAGACAGCCGGAAAGGATCTGGCGAGCGA
CAAGGCCACTTATCCCAAGCTGTTGGGGCTGGACGGTGCCCGGAGATTCGCCGCCGAGCTTGTTGAAGAAGCCAATAAGGAATTGGCCGGATTTGATCCC
GTTAAGGCCGCGCCGCTCTACCATTTCGCTAATTACATTGCTACGCGACAAAATTAG
AA sequence
>Lus10033582 pacid=23143400 polypeptide=Lus10033582 locus=Lus10033582.g ID=Lus10033582.BGIv1.0 annot-version=v1.0
MSLIHDDLPCMDNDDLRRGKPTNHKKYGEDTAILAGDALLSFSFEHVAVETPKIVSPERVVRSIAELGSAVGSAGLVAGQIVDIASEGEKVSLEELEYIH
IHKTARLLEAAVVCGAILGGADEESVKKVRKYSRCVGLLFQVVDDILDVTKSSEELGKTAGKDLASDKATYPKLLGLDGARRFAAELVEEANKELAGFDP
VKAAPLYHFANYIATRQN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10033582 0 1
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10033581 1.4 0.9702
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10011986 3.5 0.9417
AT1G70850 MLP34 MLP-like protein 34 (.1.2.3) Lus10002644 5.5 0.9311
AT3G26300 CYP71B34 "cytochrome P450, family 71, s... Lus10041667 6.1 0.8752
AT5G36930 Disease resistance protein (TI... Lus10012063 10.9 0.8401
AT4G29680 Alkaline-phosphatase-like fami... Lus10034660 12.6 0.9382
AT1G60500 DRP4C Dynamin related protein 4C (.1... Lus10025903 13.5 0.9209
AT1G68765 IDA INFLORESCENCE DEFICIENT IN ABS... Lus10034385 14.4 0.9341
AT2G41480 Peroxidase superfamily protein... Lus10020422 15.2 0.9071
AT1G20870 HSP20-like chaperones superfam... Lus10007642 15.2 0.9095

Lus10033582 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.