Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G37730 54 / 2e-10 unknown protein AT1G70780 47 / 9e-08 unknown protein AT1G23150 45 / 5e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017628 [exp] 90 / 2e-24 AT5G37730 102 / 3e-28 unknown protein Lus10019143 [exp] 51 / 2e-09 AT1G70780 167 / 4e-54 unknown protein Lus10035084 [exp] 51 / 2e-09 AT1G70780 171 / 7e-56 unknown protein Lus10034416 [exp] 51 / 3e-09 AT1G70780 168 / 8e-55 unknown protein Lus10031920 [exp] 51 / 3e-09 AT1G70780 172 / 4e-56 unknown protein Lus10039287 [exp] 39 / 9e-05 AT1G70780 104 / 4e-29 unknown protein Lus10027525 [exp] 39 / 0.0001 AT1G70780 104 / 3e-29 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G131600 [exp] 58 / 4e-12 AT1G70780 183 / 2e-60 unknown protein Potri.010G110800 [exp] 56 / 2e-11 AT1G70780 188 / 9e-63 unknown protein Potri.017G125300 [exp] 55 / 6e-11 AT1G70780 109 / 2e-31 unknown protein Potri.004G089700 [exp] 48 / 3e-08 AT5G37730 108 / 1e-30 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF00794 [flax] [poplar] PI3K_rbd PI3-kinase family, ras-binding domain
Representative CDS sequence Show only first row Show all	>Lus10033584 pacid=23143478 polypeptide=Lus10033584 locus=Lus10033584.g ID=Lus10033584.BGIv1.0 annot-version=v1.0 ATGGGAGCCTCGTCGGCAGCGGCGGTGAAGAATGAGAAGAAGAAGCGTAAGAATAACAAGTTATTAGTGAGGGTGAACGTACCGGGGAGCAAGGGGCCGA TAAGGTTGGCGGTGAAGGAGGATGACGTGGTGGATGTGGTAATCGAGTCAACGTTGAAGAGCTGTGCTAAGGAAGGCAGAGTTCCTTCACTTGGTTGTGA AGCTAGCAACTTCATTCTCTACTCTTCTAATGCCACTTCTGATTCCAAATGTACGTTTACCTAA
AA sequence Show only first row Show all	>Lus10033584 pacid=23143478 polypeptide=Lus10033584 locus=Lus10033584.g ID=Lus10033584.BGIv1.0 annot-version=v1.0 MGASSAAAVKNEKKKRKNNKLLVRVNVPGSKGPIRLAVKEDDVVDVVIESTLKSCAKEGRVPSLGCEASNFILYSSNATSDSKCTFT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G37730			unknown protein		Lus10033584 [exp]	0	1
AT5G54060		UF3GT	UDP-glucose:flavonoid 3-o-gluc...		Lus10004381 [exp]	2.0	0.9445
AT3G04030	GARP		Homeodomain-like superfamily p...		Lus10002629 [exp]	3.5	0.9514
AT5G41850			alpha/beta-Hydrolases superfam...		Lus10032373 [exp]	3.9	0.9310
AT2G39440			unknown protein		Lus10040607 [exp]	6.0	0.9362
AT2G39440			unknown protein		Lus10018300 [exp]	7.1	0.9383
AT5G13990		ATEXO70C2	exocyst subunit exo70 family p...		Lus10041536 [exp]	8.9	0.9282
AT3G15010			RNA-binding (RRM/RBD/RNP motif...		Lus10021035 [exp]	9.2	0.9148
AT4G26590		ATOPT5	ARABIDOPSIS THALIANA OLIGOPEPT...		Lus10043161 [exp]	9.5	0.8973
AT5G50670	SBP	SPL13B	SQUAMOSA PROMOTER-BINDING PROT...		Lus10015764 [exp]	10.3	0.8758
					Lus10019472 [exp]	12.5	0.9306

Compare expression of checked genes

Lus10033584 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.