Lus10033590 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G62470 99 / 1e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G62540 97 / 3e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G14820 97 / 3e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G52640 70 / 8e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G65560 70 / 1e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G62930 69 / 1e-13 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G15010 68 / 4e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G63130 68 / 5e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G38730 67 / 1e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G22470 66 / 2e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017633 438 / 2e-154 AT1G77360 183 / 2e-51 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10009123 259 / 6e-84 AT1G77360 156 / 1e-41 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10028520 253 / 1e-79 AT5G37820 215 / 4e-64 NODULIN- 26-LIKE MAJOR INTRINSIC PROTEIN 5, NOD26-like intrinsic protein 4;2 (.1)
Lus10015741 83 / 4e-18 AT3G62470 725 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10003461 78 / 2e-16 AT3G62470 718 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10030603 70 / 1e-13 AT1G52640 672 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10030887 67 / 8e-13 AT1G52640 658 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10000554 65 / 4e-12 AT3G04760 535 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10026558 65 / 6e-12 AT5G65560 881 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G126600 239 / 9e-77 AT1G77360 173 / 5e-48 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G045800 137 / 6e-38 AT1G77360 192 / 4e-55 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.014G121400 87 / 1e-19 AT3G62470 737 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G034400 77 / 5e-16 AT3G22470 476 / 1e-161 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G181900 72 / 1e-14 AT1G77360 723 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G102700 72 / 2e-14 AT1G52640 697 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G271200 70 / 1e-13 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G147700 69 / 2e-13 AT2G15630 736 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G050400 69 / 3e-13 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G038400 67 / 1e-12 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10033590 pacid=23143480 polypeptide=Lus10033590 locus=Lus10033590.g ID=Lus10033590.BGIv1.0 annot-version=v1.0
ATGGAGGCTTTGAGATGTTTCGAGTTAATGAAGAGTAAAGGCTGTTGTCCCGGTATGAGGTTTCTAGCTTCTTTTGTTGAAAAATGCTGTAAAAATAACG
ATGTTAGATCTGCTGATTCGGTTTGGGAGACGATGGTTGATGGTTTCAGGATCAGACCTGATGCAGGGTTATACAGCCTGATGATCGGTTCACATTGCTG
TTCGAGGAACACCGACAGGGCGGTACAATTGTTCGATGAGATGGTTTGTAGAGGATTATTTCCCTATGTGCAGACGAGTAACGTGTTGTTCTGGTTATTG
ATTTCAAGTAGAAGGCTGAAGGAGGCGTCGGGGTTGCTCAACGAGATGGTTAGAAACGAGTGCACCCCTAGCCAATCGAATTGCAGTCGGGCAGTTGAGG
TGTGTTTGGAATCGGGTGATGCTTATATCGCTATACTGGTTTGGAAATTGATGGTGGAGAGTTGTAAAAATTCGGACTTGGAGGAGACTGGGAACTTGTT
GATTGTGGGGCTGATTGAGCTGCAATTTGTTCCGGAAGCGGTAGTGTATGCTGAGAGTATGATTGAGAAAGGGATTAAGTTGACGTTATCGACTATTTCG
AAGTTGAAGGAGAGGCTTACGAGAGAAAGGAAGGAGATTGTGTTTGAAGAACTGCTGAAGAAGTGGACTGGCTCCTTAAAGTAG
AA sequence
>Lus10033590 pacid=23143480 polypeptide=Lus10033590 locus=Lus10033590.g ID=Lus10033590.BGIv1.0 annot-version=v1.0
MEALRCFELMKSKGCCPGMRFLASFVEKCCKNNDVRSADSVWETMVDGFRIRPDAGLYSLMIGSHCCSRNTDRAVQLFDEMVCRGLFPYVQTSNVLFWLL
ISSRRLKEASGLLNEMVRNECTPSQSNCSRAVEVCLESGDAYIAILVWKLMVESCKNSDLEETGNLLIVGLIELQFVPEAVVYAESMIEKGIKLTLSTIS
KLKERLTRERKEIVFEELLKKWTGSLK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G62470 Pentatricopeptide repeat (PPR)... Lus10033590 0 1
Lus10001956 2.0 0.8275
AT5G62030 diphthamide synthesis DPH2 fam... Lus10039108 3.9 0.7947
AT3G59520 ATRBL13 RHOMBOID-like protein 13 (.1) Lus10005310 6.0 0.7873
AT3G21740 APO4 ACCUMULATION OF PHOTOSYSTEM ON... Lus10039659 6.6 0.8233
AT5G38250 Protein kinase family protein ... Lus10038814 11.0 0.7781
AT2G40830 RHC1A RING-H2 finger C1A (.1.2.3) Lus10003698 12.5 0.8056
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Lus10000632 13.1 0.7982
AT5G23680 Sterile alpha motif (SAM) doma... Lus10036012 14.9 0.7508
AT5G01600 ATFER1 ARABIDOPSIS THALIANA FERRETIN ... Lus10002865 16.4 0.7924
Lus10019651 17.3 0.6534

Lus10033590 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.