Lus10033591 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G77360 121 / 3e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G71060 95 / 9e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G52640 77 / 1e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G04130 75 / 4e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT3G22670 75 / 4e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G74900 72 / 3e-14 OTP43 organelle transcript processing defect 43, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G77405 66 / 3e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G11310 63 / 4e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G49240 63 / 4e-11 EMB1796 embryo defective 1796, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G40400 63 / 6e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017633 503 / 6e-179 AT1G77360 183 / 2e-51 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10009123 328 / 4e-110 AT1G77360 156 / 1e-41 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10028520 324 / 7e-106 AT5G37820 215 / 4e-64 NODULIN- 26-LIKE MAJOR INTRINSIC PROTEIN 5, NOD26-like intrinsic protein 4;2 (.1)
Lus10003703 120 / 4e-33 AT1G77360 317 / 6e-107 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10001588 120 / 1e-30 AT1G77360 679 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10001633 92 / 5e-21 AT1G71060 602 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10003461 81 / 8e-17 AT3G62470 718 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10015741 80 / 2e-16 AT3G62470 725 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10011459 75 / 6e-15 AT1G20300 711 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G126600 313 / 9e-105 AT1G77360 173 / 5e-48 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G045800 182 / 4e-54 AT1G77360 192 / 4e-55 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G181900 129 / 2e-34 AT1G77360 723 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G114700 97 / 9e-23 AT1G71060 679 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G245400 92 / 5e-21 AT1G20300 768 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G055500 79 / 1e-16 AT3G04130 566 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.010G084000 78 / 5e-16 AT3G22670 489 / 3e-168 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G245500 75 / 4e-15 AT1G20300 571 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G102700 73 / 2e-14 AT1G52640 697 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G083800 67 / 2e-12 AT3G22670 428 / 3e-144 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10033591 pacid=23143489 polypeptide=Lus10033591 locus=Lus10033591.g ID=Lus10033591.BGIv1.0 annot-version=v1.0
ATGGCGGCAGAGATTGATATTACGGTGAGCCACCGCCATCATAACGGCCACATCCACCGCGACGCCGGGATTCCCGTCGGAAAACAGCATGCCTCGGCTT
CGCCTTCCGGTTCAATTCGTGCAATCGACCGCCCAGCCTTCCCTTCGTACACCAACATCCCCAATCTCCCCTCGAAAATCAACCACCTCTGCGAAATAAT
CGCCACCACTCCGTCTTCCACCGTAGAGAAAGTCCTCGCCGACTCCGGAACCGGCGGCGTCACCCAGGCGGAGATTGAGCAAGTCCTCAAGCTGGCCTAC
TCCTTCCCAGCCCCCGCCGTCAAGTTCTTCCGGTGGAGTGGAATCCTTCTCAACGGAGACCACTCCGCTTACGCTTGGAACCCCGTGGTCGATCTTCTCG
GTAAGAATTGTTTGTTCGACGCAATGTGGGACGCCGTCAAGTCAATGAGACGGAAAAGGTTGACCTCCCTCGCCACTTTCGCTTCCATATTCAGTAGCTA
TGTAATTGCCGGTAAAATAAAGGAAGCTATTATGACATTCGAGGTCATGGATCAGTACGAATGCATTCGAGATGTCGTCGCCTTGAATTCCTTGTTGAGT
GCTATATGTAGAGATGGGAAAACCGTCGACGCATCTGAATTATTGCGTGTAGCTCTCCGCCATATCATGCCTGATTCTGATTCGTATGCTATATTATTGG
AAGGGTGGGAGAAGGAGATGAATGTGGTTTGCGCTAGGAAAACTTTTAGCGAAATGATCGAATGGATCGGTTGGGATCCTCGAAATGTGCCTGAAAACTT
TCTTGTGCACTTTGCTTACATTTTCTGA
AA sequence
>Lus10033591 pacid=23143489 polypeptide=Lus10033591 locus=Lus10033591.g ID=Lus10033591.BGIv1.0 annot-version=v1.0
MAAEIDITVSHRHHNGHIHRDAGIPVGKQHASASPSGSIRAIDRPAFPSYTNIPNLPSKINHLCEIIATTPSSTVEKVLADSGTGGVTQAEIEQVLKLAY
SFPAPAVKFFRWSGILLNGDHSAYAWNPVVDLLGKNCLFDAMWDAVKSMRRKRLTSLATFASIFSSYVIAGKIKEAIMTFEVMDQYECIRDVVALNSLLS
AICRDGKTVDASELLRVALRHIMPDSDSYAILLEGWEKEMNVVCARKTFSEMIEWIGWDPRNVPENFLVHFAYIF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G77360 Tetratricopeptide repeat (TPR)... Lus10033591 0 1
AT4G20740 EMB3131 EMBRYO DEFECTIVE 3131, Pentatr... Lus10016361 5.7 0.7504
AT2G01060 GARP myb-like HTH transcriptional r... Lus10038734 6.5 0.7960
AT1G26110 DCP5 decapping 5 (.1.2) Lus10017885 7.2 0.8074
AT2G32910 DCD (Development and Cell Deat... Lus10004128 8.3 0.7913
AT3G62470 Pentatricopeptide repeat (PPR)... Lus10015741 14.0 0.7808
AT1G68750 ATPPC4 phosphoenolpyruvate carboxylas... Lus10035050 14.0 0.7656
AT5G64360 EIP9 EMF1-Interacting Protein 1, Ch... Lus10015692 17.0 0.7643
AT2G46940 unknown protein Lus10007198 19.0 0.7506
AT3G51650 unknown protein Lus10009097 22.4 0.7637
AT3G47850 unknown protein Lus10042163 23.5 0.7699

Lus10033591 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.