Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46230 50 / 1e-09 Protein of unknown function, DUF538 (.1) AT4G24130 47 / 2e-08 Protein of unknown function, DUF538 (.1) AT1G56580 39 / 2e-05 SVB SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1) AT1G09310 39 / 4e-05 Protein of unknown function, DUF538 (.1) AT1G30020 38 / 6e-05 Protein of unknown function, DUF538 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017655 [exp] 102 / 3e-30 AT1G56580 115 / 1e-33 SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1) Lus10000616 [exp] 75 / 1e-19 AT5G46230 86 / 1e-22 Protein of unknown function, DUF538 (.1) Lus10000355 [exp] 73 / 2e-18 AT5G46230 117 / 1e-34 Protein of unknown function, DUF538 (.1) Lus10017330 [exp] 50 / 1e-09 AT4G24130 209 / 3e-70 Protein of unknown function, DUF538 (.1) Lus10013912 [exp] 49 / 3e-09 AT5G46230 123 / 5e-37 Protein of unknown function, DUF538 (.1) Lus10001674 [exp] 48 / 9e-09 AT4G24130 212 / 2e-71 Protein of unknown function, DUF538 (.1) Lus10001891 [exp] 46 / 7e-08 AT5G46230 120 / 8e-36 Protein of unknown function, DUF538 (.1) Lus10039866 [exp] 44 / 8e-07 AT1G09310 196 / 5e-64 Protein of unknown function, DUF538 (.1) Lus10018630 [exp] 42 / 2e-06 AT1G09310 195 / 5e-64 Protein of unknown function, DUF538 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G084600 [exp] 49 / 3e-09 AT1G56580 96 / 9e-26 SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1) Potri.003G146400 [exp] 49 / 3e-09 AT4G24130 211 / 5e-71 Protein of unknown function, DUF538 (.1) Potri.001G084200 [exp] 49 / 4e-09 AT4G24130 208 / 5e-70 Protein of unknown function, DUF538 (.1) Potri.004G056700 [exp] 47 / 2e-08 AT1G09310 99 / 4e-27 Protein of unknown function, DUF538 (.1) Potri.013G007000 [exp] 44 / 2e-07 AT1G56580 176 / 5e-57 SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1) Potri.005G011200 [exp] 44 / 2e-07 AT1G56580 192 / 4e-63 SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1) Potri.004G064700 [exp] 44 / 4e-07 AT5G46230 184 / 4e-61 Protein of unknown function, DUF538 (.1) Potri.017G133300 [exp] 37 / 8e-05 AT1G56580 69 / 1e-15 SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033612 pacid=23143499 polypeptide=Lus10033612 locus=Lus10033612.g ID=Lus10033612.BGIv1.0 annot-version=v1.0 ATGGATCCAAAGAAAGGAGCCACGGTGAAGAAGGGCCTGGTCGAAGCAATGAACATGGCCGTTGCTCTGCTCAAAGAGTTCAACCTCCCGGAAGGAATGA TGCCGTTGGAAGACATGATCGAATCCGGGTACGTCAAGGAAACGGGCTACTTCTGGATCGTGTAG
AA sequence Show only first row Show all	>Lus10033612 pacid=23143499 polypeptide=Lus10033612 locus=Lus10033612.g ID=Lus10033612.BGIv1.0 annot-version=v1.0 MDPKKGATVKKGLVEAMNMAVALLKEFNLPEGMMPLEDMIESGYVKETGYFWIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G46230			Protein of unknown function, D...		Lus10033612 [exp]	0	1
AT5G60010			ferric reductase-like transmem...		Lus10019390 [exp]	6.9	0.9009
					Lus10004306 [exp]	9.5	0.7043
AT1G22440			Zinc-binding alcohol dehydroge...		Lus10009516 [exp]	9.7	0.9009
					Lus10019586 [exp]	9.9	0.6999
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Lus10015158 [exp]	11.9	0.9009
AT1G04670			unknown protein		Lus10004041 [exp]	13.7	0.9009
					Lus10006918 [exp]	15.3	0.9009
					Lus10013743 [exp]	15.4	0.7367
					Lus10007508 [exp]	16.8	0.9009
AT3G53690			RING/U-box superfamily protein...		Lus10042610 [exp]	18.1	0.9009

Compare expression of checked genes

Lus10033612 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.