Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G56580 55 / 5e-11 SVB SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1) AT4G24130 52 / 4e-10 Protein of unknown function, DUF538 (.1) AT1G09310 45 / 4e-07 Protein of unknown function, DUF538 (.1) AT5G49600 44 / 1e-06 Protein of unknown function, DUF538 (.1) AT5G46230 40 / 2e-05 Protein of unknown function, DUF538 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017655 [exp] 118 / 6e-36 AT1G56580 115 / 1e-33 SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1) Lus10000355 [exp] 76 / 4e-19 AT5G46230 117 / 1e-34 Protein of unknown function, DUF538 (.1) Lus10013912 [exp] 71 / 1e-17 AT5G46230 123 / 5e-37 Protein of unknown function, DUF538 (.1) Lus10001891 [exp] 71 / 2e-17 AT5G46230 120 / 8e-36 Protein of unknown function, DUF538 (.1) Lus10017330 [exp] 50 / 3e-09 AT4G24130 209 / 3e-70 Protein of unknown function, DUF538 (.1) Lus10001674 [exp] 45 / 2e-07 AT4G24130 212 / 2e-71 Protein of unknown function, DUF538 (.1) Lus10010904 [exp] 44 / 7e-07 AT1G09310 185 / 1e-60 Protein of unknown function, DUF538 (.1) Lus10031428 [exp] 44 / 8e-07 AT1G09310 185 / 2e-60 Protein of unknown function, DUF538 (.1) Lus10018630 [exp] 40 / 2e-05 AT1G09310 195 / 5e-64 Protein of unknown function, DUF538 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G084600 [exp] 75 / 6e-19 AT1G56580 96 / 9e-26 SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1) Potri.004G056700 [exp] 75 / 6e-19 AT1G09310 99 / 4e-27 Protein of unknown function, DUF538 (.1) Potri.017G133300 [exp] 74 / 1e-18 AT1G56580 69 / 1e-15 SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1) Potri.003G146400 [exp] 55 / 3e-11 AT4G24130 211 / 5e-71 Protein of unknown function, DUF538 (.1) Potri.001G084200 [exp] 52 / 7e-10 AT4G24130 208 / 5e-70 Protein of unknown function, DUF538 (.1) Potri.005G011200 [exp] 52 / 1e-09 AT1G56580 192 / 4e-63 SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1) Potri.013G007000 [exp] 49 / 8e-09 AT1G56580 176 / 5e-57 SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1) Potri.004G064700 [exp] 48 / 2e-08 AT5G46230 184 / 4e-61 Protein of unknown function, DUF538 (.1) Potri.010G149100 [exp] 42 / 7e-06 AT5G49600 152 / 3e-47 Protein of unknown function, DUF538 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04398 [flax] [poplar] DUF538 Protein of unknown function, DUF538
Representative CDS sequence Show only first row Show all	>Lus10033613 pacid=23143257 polypeptide=Lus10033613 locus=Lus10033613.g ID=Lus10033613.BGIv1.0 annot-version=v1.0 ATGATCGGAAAGCAAGTCAGTTACGACAAGAAGATCAGCAGCTACATCAAGAAGAACAGGGCCAAGAAACTCAAAGGCGTCAAGGGTAAGGAGCTCATGT TGTGGCCGCCCGTCCGCGAGATGGCCGTCGACGAGAATCCGTCGTCCGGGAAAATTCATATTAAGAGTGTTGGTGGTATCGGTGAGTCTTTCCCGGTGGC TGCTTTCGCCGCCGGTCAGTAG
AA sequence Show only first row Show all	>Lus10033613 pacid=23143257 polypeptide=Lus10033613 locus=Lus10033613.g ID=Lus10033613.BGIv1.0 annot-version=v1.0 MIGKQVSYDKKISSYIKKNRAKKLKGVKGKELMLWPPVREMAVDENPSSGKIHIKSVGGIGESFPVAAFAAGQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G56580		SVB	SMALLER WITH VARIABLE BRANCHES...		Lus10033613 [exp]	0	1
AT4G23470			PLAC8 family protein (.1.2.3)		Lus10005117 [exp]	1.4	0.8090
AT1G35710			Protein kinase family protein ...		Lus10002293 [exp]	3.9	0.7357
AT5G59790			Domain of unknown function (DU...		Lus10030328 [exp]	4.1	0.6667
AT5G35390			Leucine-rich repeat protein ki...		Lus10017144 [exp]	6.0	0.7267
AT1G10010		AAP8, ATAAP8	amino acid permease 8 (.1)		Lus10037248 [exp]	11.3	0.7894
					Lus10003693 [exp]	11.8	0.7150
AT2G04865			Aminotransferase-like, plant m...		Lus10003728 [exp]	13.4	0.7890
AT5G64030			S-adenosyl-L-methionine-depend...		Lus10000839 [exp]	14.0	0.7810
AT5G10530			Concanavalin A-like lectin pro...		Lus10042310 [exp]	21.8	0.7168
AT1G24420			HXXXD-type acyl-transferase fa...		Lus10033658 [exp]	27.1	0.7108

Compare expression of checked genes

Lus10033613 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.