Lus10033619 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18550 235 / 7e-76 AtDSEL Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1)
AT2G31100 233 / 6e-75 alpha/beta-Hydrolases superfamily protein (.1)
AT1G06250 223 / 7e-71 alpha/beta-Hydrolases superfamily protein (.1)
AT1G06800 175 / 2e-52 PLA-I{gamma}1 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2)
AT2G30550 169 / 5e-50 alpha/beta-Hydrolases superfamily protein (.1.2)
AT2G42690 158 / 3e-46 alpha/beta-Hydrolases superfamily protein (.1)
AT1G30370 158 / 3e-45 DLAH DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
AT1G51440 154 / 1e-43 alpha/beta-Hydrolases superfamily protein (.1)
AT2G31690 134 / 1e-36 alpha/beta-Hydrolases superfamily protein (.1)
AT1G05800 130 / 4e-35 DGL DONGLE, alpha/beta-Hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017668 447 / 3e-159 AT4G18550 420 / 1e-145 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1)
Lus10013936 202 / 2e-63 AT4G18550 345 / 2e-116 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1)
Lus10013932 201 / 4e-63 AT4G18550 427 / 5e-149 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1)
Lus10000985 199 / 4e-63 AT4G18550 375 / 1e-129 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1)
Lus10013935 201 / 6e-63 AT4G18550 337 / 2e-113 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1)
Lus10017975 159 / 2e-46 AT2G42690 524 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Lus10038524 148 / 4e-42 AT1G30370 526 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
Lus10023281 144 / 1e-40 AT1G30370 342 / 2e-113 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
Lus10038526 145 / 3e-40 AT1G30370 539 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G054800 273 / 1e-90 AT4G18550 516 / 0.0 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1)
Potri.011G064400 271 / 5e-90 AT4G18550 501 / 3e-177 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1)
Potri.015G026500 182 / 2e-55 AT4G18550 326 / 5e-109 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1)
Potri.004G054600 178 / 7e-54 AT4G18550 384 / 1e-131 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1)
Potri.015G026400 173 / 7e-52 AT4G18550 330 / 5e-110 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1)
Potri.003G101800 172 / 2e-51 AT2G42690 531 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Potri.002G044700 171 / 5e-50 AT1G06800 662 / 0.0 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2)
Potri.005G218500 162 / 1e-46 AT1G06800 652 / 0.0 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2)
Potri.009G051900 159 / 2e-45 AT1G51440 700 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Potri.009G057900 155 / 2e-44 AT1G30370 626 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0028 AB_hydrolase PF01764 Lipase_3 Lipase (class 3)
Representative CDS sequence
>Lus10033619 pacid=23143360 polypeptide=Lus10033619 locus=Lus10033619.g ID=Lus10033619.BGIv1.0 annot-version=v1.0
ATGGCTCAGTCCACCCTCAACTCTTTCAACGCCGACCAATTCTCCAAGTACGCTGGTGACTGCCGCTACCCCATGCTAACCTACTTCGACAAGGTGGGAT
TAACCATTTGCAATCCATTCAAGTACCAAATCACAAAGTACTTGTACGCCACGTCACAACTCCCTCTTCCAGATTGCTTCATCATCAAGTCACTGTCCGA
TGAAGCATGGGACAAGCAATCCAACTGGATGGGATTCGTGGCAGTCGCTACTGACGAAGGCAAAGCTGCATTGGGTCGGAGGGACATCTTGATCGCTTGG
AGAGCCACGGTCCAGGCGCTGGAACGGATCGAAGATTTCGATCACCCTCTTGTCCCTGCTACCCATATATTCGGCCAAGGTTCCAAACCCTTGGTTCATA
GAGTCTGGCTCTCTATTTACACCTCCGATAACCCTGATTCCGCCTTCAACAAAACCAGCGCCAGGGTTCAGGTTCTCGAGGAAGTGGAAGCCTTGGTGAA
GCAGTACAAGGACGAGGAGATCAGCATCACAGTAAGAGGACACAGCCTAGGCGGAGCTCTAGCAACTCTCAACGCAGCAGACATTGTAACCAACTGCTAC
AACGATCATAACAAAGAATCGAAAAACCCAGCCAATCCATGTTCGGTGACAGTATTTACCTACGGGTGTCCGCGAGTTGGAGACATCAGCTTCAAGAACC
TAAATAAGTTGAAAATTTAG
AA sequence
>Lus10033619 pacid=23143360 polypeptide=Lus10033619 locus=Lus10033619.g ID=Lus10033619.BGIv1.0 annot-version=v1.0
MAQSTLNSFNADQFSKYAGDCRYPMLTYFDKVGLTICNPFKYQITKYLYATSQLPLPDCFIIKSLSDEAWDKQSNWMGFVAVATDEGKAALGRRDILIAW
RATVQALERIEDFDHPLVPATHIFGQGSKPLVHRVWLSIYTSDNPDSAFNKTSARVQVLEEVEALVKQYKDEEISITVRGHSLGGALATLNAADIVTNCY
NDHNKESKNPANPCSVTVFTYGCPRVGDISFKNLNKLKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18550 AtDSEL Arabidopsis thaliana DAD1-like... Lus10033619 0 1

Lus10033619 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.