Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04530 79 / 3e-18 KCS19 3-ketoacyl-CoA synthase 19 (.1) AT2G28630 78 / 3e-18 KCS12 3-ketoacyl-CoA synthase 12 (.1) AT1G07720 77 / 9e-18 KCS3 3-ketoacyl-CoA synthase 3 (.1) AT3G52160 47 / 4e-07 KCS15 3-ketoacyl-CoA synthase 15 (.1) AT1G01120 41 / 3e-05 KCS1 3-ketoacyl-CoA synthase 1 (.1) AT2G26250 39 / 0.0002 KCS10, FDH FIDDLEHEAD, 3-ketoacyl-CoA synthase 10 (.1) AT5G49070 38 / 0.0004 KCS21 3-ketoacyl-CoA synthase 21 (.1.2) AT4G34520 38 / 0.0005 KCS18, FAE1 FATTY ACID ELONGATION1, 3-ketoacyl-CoA synthase 18 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033625 [exp] 142 / 8e-41 AT5G04530 461 / 9e-156 3-ketoacyl-CoA synthase 19 (.1) Lus10033626 [exp] 136 / 3e-39 AT5G04530 467 / 4e-162 3-ketoacyl-CoA synthase 19 (.1) Lus10002191 [exp] 95 / 6e-24 AT5G04530 495 / 1e-173 3-ketoacyl-CoA synthase 19 (.1) Lus10039906 [exp] 94 / 8e-24 AT5G04530 497 / 1e-172 3-ketoacyl-CoA synthase 19 (.1) Lus10015222 [exp] 86 / 9e-21 AT2G28630 654 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Lus10040333 [exp] 83 / 9e-20 AT5G04530 611 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Lus10023458 [exp] 83 / 1e-19 AT5G04530 605 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Lus10005434 [exp] 78 / 4e-18 AT2G28630 664 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Lus10004918 [exp] 74 / 1e-16 AT2G28630 560 / 0.0 3-ketoacyl-CoA synthase 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G212600 [exp] 88 / 1e-21 AT5G04530 576 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Potri.013G119600 [exp] 87 / 3e-21 AT5G04530 561 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Potri.013G119800 [exp] 81 / 6e-19 AT5G04530 558 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Potri.001G234500 [exp] 77 / 1e-17 AT2G28630 647 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Potri.013G120100 [exp] 76 / 2e-17 AT5G04530 543 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Potri.009G026800 [exp] 76 / 3e-17 AT2G28630 660 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Potri.002G178000 [exp] 45 / 1e-06 AT1G01120 826 / 0.0 3-ketoacyl-CoA synthase 1 (.1) Potri.019G091600 [exp] 44 / 3e-06 AT5G04530 520 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Potri.006G080400 [exp] 41 / 4e-05 AT2G26250 575 / 0.0 FIDDLEHEAD, 3-ketoacyl-CoA synthase 10 (.1) Potri.013G015100 [exp] 40 / 9e-05 AT1G71160 486 / 6e-170 3-ketoacyl-CoA synthase 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0046 [flax] [poplar] Thiolase PF08392 [flax] [poplar] FAE1_CUT1_RppA FAE1/Type III polyketide synthase-like protein
Representative CDS sequence Show only first row Show all	>Lus10033628 pacid=23143314 polypeptide=Lus10033628 locus=Lus10033628.g ID=Lus10033628.BGIv1.0 annot-version=v1.0 ATGGAGATCCATGTCTTCTTGGCATTAATCACCATAATGATCCTAACCATACCAATCCTTCACCAGTTTCTCGAATTCATGCAACGAAAGCTCGACACAA AATCATGTTGTTACCTCTTGGCTTACCAGTGCTACAAACCACCCGATGATCTGAAGCTGAGCATGGGAAACTCCACTAAAATCACCTTCCGGAACCCTAA CCTAGGGCTTGAAGAGTACAGGTTCCTCATCAAAGTCATCTCCCGCTCCGGTATCGGCAATGAGACCTACTGCTCCGGGACCTTCCTCGACGGCCGCGAA ATGTCCCCGACATTAGAGTAG
AA sequence Show only first row Show all	>Lus10033628 pacid=23143314 polypeptide=Lus10033628 locus=Lus10033628.g ID=Lus10033628.BGIv1.0 annot-version=v1.0 MEIHVFLALITIMILTIPILHQFLEFMQRKLDTKSCCYLLAYQCYKPPDDLKLSMGNSTKITFRNPNLGLEEYRFLIKVISRSGIGNETYCSGTFLDGRE MSPTLE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28630		KCS12	3-ketoacyl-CoA synthase 12 (.1...		Lus10033628 [exp]	0	1
					Lus10002332 [exp]	2.8	1.0000
AT1G02335		GL22	germin-like protein subfamily ...		Lus10004856 [exp]	4.0	1.0000
AT2G43870			Pectin lyase-like superfamily ...		Lus10011417 [exp]	4.9	1.0000
AT3G05950			RmlC-like cupins superfamily p...		Lus10023351 [exp]	5.7	1.0000
AT3G53710		AGD6	ARF-GAP domain 6 (.1.2)		Lus10012991 [exp]	6.3	1.0000
AT3G19270		CYP707A4	"cytochrome P450, family 707, ...		Lus10014056 [exp]	6.9	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10031075 [exp]	7.5	1.0000
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Lus10033189 [exp]	8.0	1.0000
AT2G31750		UGT74D1	UDP-glucosyl transferase 74D1 ...		Lus10009409 [exp]	9.0	1.0000
AT4G35500			Protein kinase superfamily pro...		Lus10035984 [exp]	9.2	0.9586

Compare expression of checked genes

Lus10033628 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.