Lus10033631 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G48340 206 / 4e-65 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1)
AT4G11320 188 / 3e-58 Papain family cysteine protease (.1)
AT5G50260 187 / 4e-58 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
AT5G45890 186 / 1e-57 SAG12 senescence-associated gene 12 (.1)
AT1G47128 188 / 2e-57 RD21A, RD21 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
AT4G11310 182 / 5e-56 RD21A, RD21 Papain family cysteine protease (.1)
AT1G06260 180 / 2e-55 Cysteine proteinases superfamily protein (.1)
AT3G48350 179 / 7e-55 CEP3 cysteine endopeptidase 3, Cysteine proteinases superfamily protein (.1)
AT5G43060 179 / 9e-54 Granulin repeat cysteine protease family protein (.1)
AT1G20850 176 / 1e-53 XCP2 xylem cysteine peptidase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017674 365 / 3e-128 AT1G06260 310 / 2e-104 Cysteine proteinases superfamily protein (.1)
Lus10002184 221 / 1e-71 AT1G06260 384 / 1e-133 Cysteine proteinases superfamily protein (.1)
Lus10028501 192 / 3e-60 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Lus10003275 192 / 3e-60 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Lus10032406 192 / 4e-60 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Lus10028502 192 / 4e-60 AT5G45890 394 / 3e-137 senescence-associated gene 12 (.1)
Lus10039901 194 / 5e-60 AT1G06260 346 / 4e-117 Cysteine proteinases superfamily protein (.1)
Lus10006542 192 / 6e-60 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Lus10020723 191 / 9e-60 AT5G45890 398 / 3e-139 senescence-associated gene 12 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G183100 196 / 3e-61 AT5G50260 489 / 2e-174 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Potri.014G024100 192 / 6e-59 AT5G43060 646 / 0.0 Granulin repeat cysteine protease family protein (.1)
Potri.007G076000 187 / 3e-58 AT5G45890 407 / 2e-142 senescence-associated gene 12 (.1)
Potri.007G076100 187 / 5e-58 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1)
Potri.007G075900 187 / 5e-58 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1)
Potri.007G075300 186 / 1e-57 AT5G45890 406 / 6e-142 senescence-associated gene 12 (.1)
Potri.005G088600 185 / 4e-57 AT5G45890 406 / 8e-142 senescence-associated gene 12 (.1)
Potri.011G064900 184 / 4e-57 AT5G45890 401 / 3e-140 senescence-associated gene 12 (.1)
Potri.012G090900 185 / 5e-57 AT5G50260 561 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Potri.015G087500 184 / 7e-57 AT5G50260 530 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00112 Peptidase_C1 Papain family cysteine protease
Representative CDS sequence
>Lus10033631 pacid=23143281 polypeptide=Lus10033631 locus=Lus10033631.g ID=Lus10033631.BGIv1.0 annot-version=v1.0
ATGTACCTTCGTCTGTTGCCTAAGAATTCAAGCAAGGATCAGAAGCATGCCAATTTCAGCTGCGATGATTTGCCGGAGAAGGTAGATTGGAGGAAGAAAG
GTACTGTTACTGAGGTCAAAAATCAATTATGCGGAGATAGTTGGGCATTCTCGACTGTGGCAGCTGTCGAGGGCTTCCACAAAATCAAGACAAGAAAACT
AACGACTCTTTCGGAACAAGAGCTCGTAGACTGTGTTGGTGGTGGGGACGGGTGCAAAGGTGGGGCCGTAGAGGATGCATACGACTTCATCACGGAGATT
GGGGGACTAACGACTAATGATAACTATCCTTACAAAGGCAGAGATGGAGTTTGCCAGAAAAAGAAACTGAAACATCCTTCTGCAAAAATTAATGGATATG
AAGTATTACGTACCGACAACGAGACAATCCTCCAAGCCTCTGTTGCAAAGCAGCCTGGTATCTTCATTGGACCCTGCAAATCAGACCTCAACCACGGAGT
CGCAGCAGTTGGGTATGGAGCTGAACATGGTAAGAAGTACTGGATTCTGAAAAGTTCATGGGGGAAAGACTGGGGAGAAGCTGGATACATCAGGTTGCCA
CGTGATGTGAAGGAGAAAGGTGGCAAGTGCAGCATTGCCATGGCAATCAGTTTCCTGTCTGAATTCGTATTGTCTCCCATGTGA
AA sequence
>Lus10033631 pacid=23143281 polypeptide=Lus10033631 locus=Lus10033631.g ID=Lus10033631.BGIv1.0 annot-version=v1.0
MYLRLLPKNSSKDQKHANFSCDDLPEKVDWRKKGTVTEVKNQLCGDSWAFSTVAAVEGFHKIKTRKLTTLSEQELVDCVGGGDGCKGGAVEDAYDFITEI
GGLTTNDNYPYKGRDGVCQKKKLKHPSAKINGYEVLRTDNETILQASVAKQPGIFIGPCKSDLNHGVAAVGYGAEHGKKYWILKSSWGKDWGEAGYIRLP
RDVKEKGGKCSIAMAISFLSEFVLSPM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G48340 CEP2 cysteine endopeptidase 2, Cyst... Lus10033631 0 1
AT5G36930 Disease resistance protein (TI... Lus10024886 1.0 0.9122
AT1G17330 Metal-dependent phosphohydrola... Lus10040985 5.5 0.8956
AT5G15340 Pentatricopeptide repeat (PPR)... Lus10033775 6.6 0.8874
AT3G62140 unknown protein Lus10009976 7.7 0.8842
AT4G28830 S-adenosyl-L-methionine-depend... Lus10011107 10.2 0.8971
AT3G18820 RAB71, AtRABG3f... RAB GTPase homolog G3F (.1) Lus10042328 13.6 0.8843
AT5G58050 GDPDL6, SVL4 Glycerophosphodiester phosphod... Lus10000055 15.9 0.8534
AT5G56040 Leucine-rich receptor-like pro... Lus10005847 16.4 0.8221
AT5G19410 ABCG23 ATP-binding cassette G23, ABC-... Lus10017683 18.4 0.8550
AT2G43080 AT-P4H-1 P4H isoform 1 (.1) Lus10035434 23.2 0.8488

Lus10033631 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.