Lus10033632 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06270 386 / 3e-134 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G53700 80 / 4e-16 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G64320 69 / 1e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G12775 66 / 2e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G30290 66 / 2e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G12620 65 / 3e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G22470 64 / 5e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G20090 64 / 5e-11 EMB1025 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G05670 64 / 8e-11 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
AT1G12700 63 / 1e-10 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017675 600 / 0 AT1G06270 397 / 1e-138 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10012328 70 / 6e-13 AT3G53700 1010 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10006373 70 / 6e-13 AT3G53700 1012 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10038377 66 / 1e-11 AT4G20090 841 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10038974 64 / 8e-11 AT1G74580 911 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10042307 63 / 1e-10 AT1G74900 549 / 0.0 organelle transcript processing defect 43, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10012068 62 / 2e-10 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10036238 62 / 3e-10 AT4G20090 832 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10027914 62 / 3e-10 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G124100 373 / 3e-129 AT1G06270 360 / 2e-124 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G379500 74 / 3e-14 AT3G14580 442 / 2e-154 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G075900 72 / 1e-13 AT4G20090 806 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G046000 71 / 2e-13 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G038400 68 / 3e-12 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050180 67 / 4e-12 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.004G205600 67 / 5e-12 AT2G17140 1150 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G013300 67 / 6e-12 AT3G53700 1092 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G050400 67 / 6e-12 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G046100 66 / 2e-11 AT1G12700 512 / 1e-173 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10033632 pacid=23143363 polypeptide=Lus10033632 locus=Lus10033632.g ID=Lus10033632.BGIv1.0 annot-version=v1.0
ATGAAGAAATCACACCACCTCCGGCCGATCATTCAATCCCTCCCCCGCCGCACAATCTCCACTTCCTCGTCGACCCTGCAACAATCAATTCGATCCGCAA
TCGAATCCCGAACCTTCCACCAAATCCCAGACCTTCTCAGTTCATCCACCGTCCCATGGCACAACCCAAATCCTTTCTCCTTCCTCTCCACCACCCCACT
CCACGTCACAACCAAGCTCATCGACGATGTCTTACAGTCCTTCATCTCGCTCCGACCACGGTCTCGCGCCAAGATCGCTTACGACTGCCTCCTCGCTTAC
GCTCTCCAGTCTCCTCACCCGCTCCCTCTCGCTCTCACCGTCCTCCAGCGTACACTCCGATCTGGCTGCACGCCGTTCCCTCAGTCTCAGCTCTTCCTAT
CCTCCGCCTGGCTCGATCGCCGCCGGGGGAGGATGATTCCGATTCTTCCTCACTCCGTCGCCGGGATTGTATCCGAGATGAGGTTGATTGGATACAGCCC
CGACAGTGGGACGTGTAACTATCTGATTTCGTCTCTGTGTGCTGTTGATGAGTTAGCAGAGGCTGTGAATGTCTTGAAAGGTATGGCTAGAGCTGGGTGC
GTTCCTGATTTGGAGAGCTATGGTTCTGTTATCAGTGCAATGTGTGTAGCTAGAAAAAGTAGTGACGCTTTGGAGCTTTTGAAGGAGATGGTTGTTTTGA
ATGGATTGACTCCACGGCAGGGGACTGTGAAGAGAGTTGCTGCGGTGTTGCGAGCGAATCGGGAGATACGGAGTGCTGTTGAACTGATTGAGTTCTTGGA
GATGAAGAGCTATGCTGTTGGGTTTGAAGGTTATGAGGTGGTTCTTGAAGGGTGCTTGGAATGCAAAGAGTACATTTTGGGTGCAAAGATAGTTATGAGA
ATGACTGGGAAGGGTTTTATACCGTATATCAAGTTTAGGCAAAAGGTTGTCCAGGGATTGATTGATGCTGGACAGTGGCAATTGGCCTGTTCTGTGAGGC
AAAGGTTTGCAGAACTGAGTTCTTAG
AA sequence
>Lus10033632 pacid=23143363 polypeptide=Lus10033632 locus=Lus10033632.g ID=Lus10033632.BGIv1.0 annot-version=v1.0
MKKSHHLRPIIQSLPRRTISTSSSTLQQSIRSAIESRTFHQIPDLLSSSTVPWHNPNPFSFLSTTPLHVTTKLIDDVLQSFISLRPRSRAKIAYDCLLAY
ALQSPHPLPLALTVLQRTLRSGCTPFPQSQLFLSSAWLDRRRGRMIPILPHSVAGIVSEMRLIGYSPDSGTCNYLISSLCAVDELAEAVNVLKGMARAGC
VPDLESYGSVISAMCVARKSSDALELLKEMVVLNGLTPRQGTVKRVAAVLRANREIRSAVELIEFLEMKSYAVGFEGYEVVLEGCLECKEYILGAKIVMR
MTGKGFIPYIKFRQKVVQGLIDAGQWQLACSVRQRFAELSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06270 Pentatricopeptide repeat (PPR)... Lus10033632 0 1
AT5G40870 UKL1, ATUK/UPRT... URIDINE KINASE-LIKE 1, uridine... Lus10035216 13.0 0.6493
AT1G01770 unknown protein Lus10014782 23.9 0.6919
AT4G13980 HSF AT-HSFA5 HEAT SHOCK TRANSCRIPTION FACTO... Lus10016634 50.6 0.6511
AT3G61600 ATPOB1 POZ/BTB containin G-protein 1 ... Lus10017545 184.5 0.5895

Lus10033632 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.