Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28010 112 / 3e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G53700 85 / 1e-20 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G22470 77 / 6e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G05670 77 / 1e-17 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2) AT3G60050 77 / 1e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G13040 77 / 1e-17 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G41170 77 / 1e-17 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G22670 76 / 2e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G01110 76 / 3e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G64320 75 / 6e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017684 [exp] 197 / 7e-61 AT4G28010 596 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10032648 [exp] 84 / 6e-21 AT3G16890 225 / 1e-69 pentatricopeptide (PPR) domain protein 40 (.1) Lus10043104 [exp] 82 / 1e-19 AT3G16890 720 / 0.0 pentatricopeptide (PPR) domain protein 40 (.1) Lus10000364 [exp] 82 / 1e-19 AT1G22960 619 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10039056 [exp] 81 / 5e-19 AT5G64320 832 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10034616 [exp] 80 / 9e-19 AT1G22960 617 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10006373 [exp] 80 / 9e-19 AT3G53700 1012 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10012328 [exp] 80 / 1e-18 AT3G53700 1010 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10003433 [exp] 80 / 1e-18 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G069600 [exp] 135 / 2e-38 AT4G28010 661 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G271200 [exp] 82 / 2e-19 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G049400 [exp] 80 / 1e-18 AT1G79540 787 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.019G021200 [exp] 80 / 1e-18 AT1G12700 491 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.010G098400 [exp] 79 / 2e-18 AT2G02150 924 / 0.0 EMBRYO DEFECTIVE 2794, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.015G105400 [exp] 78 / 4e-18 AT5G61990 773 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G050500 [exp] 78 / 5e-18 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G046100 [exp] 77 / 7e-18 AT1G12700 512 / 1e-173 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G242200 [exp] 77 / 9e-18 AT1G62930 472 / 4e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G047400 [exp] 77 / 1e-17 AT1G63080 341 / 1e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10033639 pacid=23143436 polypeptide=Lus10033639 locus=Lus10033639.g ID=Lus10033639.BGIv1.0 annot-version=v1.0 ATGCGAGACTCGAACTATGTCCCTGATGTTGTCTCATTTAATACGATGATTGATGGATTGTTGAAAGCCGGAGACGTTCAGTATGCCAAAGAGCTGCTTA ATGAAATGGTGCAAATGGGTCAGATGCCGGATGTTTTTACATATACTGTGTTGATTAATCGATTGTCGAAACTCGGACAGGTGGACGAGGCTAAGGGAAT CTTTGAGAGGATGGTTTCGTTAGGTGTTAAACCAGACAGCCACGTATATGATTCGTTGTTAAAACGAGTGCTTTCGAAAGGGGAAGCTGAAGAGACCATT GATTTGCTGCGTTGA
AA sequence Show only first row Show all	>Lus10033639 pacid=23143436 polypeptide=Lus10033639 locus=Lus10033639.g ID=Lus10033639.BGIv1.0 annot-version=v1.0 MRDSNYVPDVVSFNTMIDGLLKAGDVQYAKELLNEMVQMGQMPDVFTYTVLINRLSKLGQVDEAKGIFERMVSLGVKPDSHVYDSLLKRVLSKGEAEETI DLLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28010			Tetratricopeptide repeat (TPR)...		Lus10033639 [exp]	0	1
AT4G28010			Tetratricopeptide repeat (TPR)...		Lus10033640 [exp]	3.2	0.7768
AT3G61860		ATRSP31, At-RS3...	arginine/serine-rich splicing ...		Lus10016981 [exp]	3.7	0.8123
AT4G14050			Pentatricopeptide repeat (PPR)...		Lus10018278 [exp]	6.6	0.8265
					Lus10033638 [exp]	22.0	0.6536
AT3G63090			Ubiquitin carboxyl-terminal hy...		Lus10028011 [exp]	22.6	0.6739
AT5G37570			Pentatricopeptide repeat (PPR-...		Lus10022701 [exp]	29.3	0.7637
AT1G16280		SWA3, AtRH36	SLOW WALKER 3, Arabidopsis tha...		Lus10029596 [exp]	29.7	0.7659
AT3G26540			Tetratricopeptide repeat (TPR)...		Lus10032922 [exp]	32.7	0.7772
AT5G66631			Tetratricopeptide repeat (TPR)...		Lus10016792 [exp]	34.5	0.7722
AT3G18100	MYB	ATMYB4R1	myb domain protein 4r1 (.1.2.3...		Lus10009636 [exp]	35.8	0.7645

Compare expression of checked genes

Lus10033639 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.