Lus10033640 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28010 149 / 5e-42 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G22470 117 / 5e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G05670 112 / 4e-29 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
AT1G62670 110 / 1e-28 RPF2 rna processing factor 2 (.1)
AT5G16640 107 / 2e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G09820 107 / 2e-27 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT5G46100 106 / 3e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G61990 106 / 5e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G53700 105 / 1e-26 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G63230 102 / 1e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017684 333 / 1e-111 AT4G28010 596 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10036020 121 / 4e-32 AT5G61990 592 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10027267 105 / 1e-26 AT1G74580 813 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10038974 105 / 2e-26 AT1G74580 911 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10032789 101 / 7e-26 AT1G09820 250 / 4e-78 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10025942 97 / 1e-25 AT1G62680 154 / 3e-44 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10006373 102 / 2e-25 AT3G53700 1012 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10010410 102 / 2e-25 AT5G59900 998 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10021074 100 / 2e-25 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G069600 223 / 2e-69 AT4G28010 661 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.018G038300 120 / 4e-32 AT1G12700 490 / 8e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.016G025600 119 / 1e-31 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G014500 115 / 3e-30 AT1G09820 696 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.017G032100 115 / 4e-30 AT1G62930 451 / 2e-152 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G074500 114 / 5e-30 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.015G105400 113 / 3e-29 AT5G61990 773 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G074700 110 / 1e-28 AT1G62930 481 / 1e-164 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G242500 110 / 2e-28 AT1G62930 473 / 1e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G234500 110 / 2e-28 AT1G74580 1034 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10033640 pacid=23143526 polypeptide=Lus10033640 locus=Lus10033640.g ID=Lus10033640.BGIv1.0 annot-version=v1.0
ATGGAAATGATGTTGGAAAAGGGGAAGAAGAAAAAACCAGATGTTGTTTCTTACAATTCATTACTAATGGGACTTTGCAACAATGGTCAGGTTGAAGAGG
CACTGAAGTTCTTCTTCAATGTGTTTAAGAAGGATCGGAATCTCATTGAGCCGGATGTGTTCACTTTCAACATTCTGATACAAGGGCTCTGCAAAAAAGG
TTGCCTTGACAAAGCTATGGAGATTTACGATACGATGATCGCTCGTGGGGTTTCCGGTAATTTGATAACTTACAATGTTCTGATTGGGGAGCATCTAAAG
TCTGGCTTAGTTGACGAAGCTATGTGTCACTGGAAACATGTTCATAAGCTCGGACTTGTTCCCAATTCAATGACGTATAGTTTCATGATCGATGGACTCT
GTAAGATTTGTTTGCTTAATGTCGCGAAAGGACTCTTCACCAAGATGAAAATGCGTGGACTTGTCCCCACATTATCGGACTACAATTCGTTGGTGGCATC
GCTATGTAAAGAAAGTAACTTGGAGTAG
AA sequence
>Lus10033640 pacid=23143526 polypeptide=Lus10033640 locus=Lus10033640.g ID=Lus10033640.BGIv1.0 annot-version=v1.0
MEMMLEKGKKKKPDVVSYNSLLMGLCNNGQVEEALKFFFNVFKKDRNLIEPDVFTFNILIQGLCKKGCLDKAMEIYDTMIARGVSGNLITYNVLIGEHLK
SGLVDEAMCHWKHVHKLGLVPNSMTYSFMIDGLCKICLLNVAKGLFTKMKMRGLVPTLSDYNSLVASLCKESNLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G28010 Tetratricopeptide repeat (TPR)... Lus10033640 0 1
AT4G28010 Tetratricopeptide repeat (TPR)... Lus10033639 3.2 0.7768
AT4G28010 Tetratricopeptide repeat (TPR)... Lus10033641 4.2 0.7764
AT4G14050 Pentatricopeptide repeat (PPR)... Lus10018278 12.6 0.7796
Lus10033638 12.9 0.6611
AT4G02220 zinc finger (MYND type) family... Lus10029718 22.4 0.7139
AT3G63090 Ubiquitin carboxyl-terminal hy... Lus10028011 23.0 0.6713
AT5G41190 unknown protein Lus10008488 45.4 0.7227
AT1G16280 SWA3, AtRH36 SLOW WALKER 3, Arabidopsis tha... Lus10029596 45.8 0.7358
AT5G61370 Pentatricopeptide repeat (PPR)... Lus10000564 48.1 0.7405
AT4G01100 ADNT1 adenine nucleotide transporter... Lus10032364 52.5 0.6620

Lus10033640 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.