Lus10033641 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28010 120 / 2e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G63080 114 / 3e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G62910 111 / 3e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G46100 110 / 4e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G62670 110 / 9e-29 RPF2 rna processing factor 2 (.1)
AT5G16640 109 / 1e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G62914 109 / 2e-28 pentatricopeptide (PPR) repeat-containing protein (.1)
AT1G62720 108 / 2e-28 AtNG1 novel gene 1, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT3G16710 108 / 2e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G62590 108 / 4e-28 pentatricopeptide (PPR) repeat-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017684 273 / 7e-89 AT4G28010 596 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015397 106 / 2e-27 AT5G46100 593 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10042452 105 / 3e-27 AT1G53330 442 / 1e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10028943 102 / 3e-27 AT5G01110 299 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10007468 103 / 3e-26 AT5G01110 808 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10005303 103 / 5e-26 AT1G30290 1037 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10024962 102 / 5e-26 AT1G62680 346 / 3e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10014244 102 / 8e-26 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10027916 102 / 9e-26 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G069600 161 / 6e-47 AT4G28010 661 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G034300 113 / 4e-30 AT1G62930 397 / 4e-133 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.014G117600 112 / 1e-29 AT1G12700 330 / 1e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G032600 111 / 4e-29 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G014500 110 / 1e-28 AT1G09820 696 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.013G034200 109 / 2e-28 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G130600 107 / 6e-28 AT1G12700 330 / 3e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G038400 107 / 7e-28 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050180 107 / 1e-27 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.011G057900 106 / 2e-27 AT5G46100 627 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10033641 pacid=23143268 polypeptide=Lus10033641 locus=Lus10033641.g ID=Lus10033641.BGIv1.0 annot-version=v1.0
ATGGAAGCATCAGCAAATTCGTTTACGTACGCAACGTTGATTGATTGTCTTTGCAAAGGTGGCAAATTGGATGATGCTTTGTCATTGTTGGAGGAGATGA
AGAGGAAAAGTTTAAATGTTGATGTTGTTGTATACGGTTCACTGATCAATGGCTTCGTTAGTAGAGGACGGTACGATGACGGGAAGAAAATTTTCGATGA
GATGATGCAGAAAGGGGTTATGCCGAATGTGGTTGTGTATAGCTACTTGATGAATGGTCTCTGTAAGATGAAGCAGTGGAATGTGGTGATGAATATGCTG
ACGGCCATGTCCGAAATGGGAGTTGATCCTGATGTTGTTACTTATACTTATCTGATTAAAGGGTTGTGCAAAGATGGGAAGTCTAGTAAGGCGGTGGAAT
TGTTTCGTCGGATCCAAGATAGGGACGAAGATGTTGAATGTTGTACTTTATAA
AA sequence
>Lus10033641 pacid=23143268 polypeptide=Lus10033641 locus=Lus10033641.g ID=Lus10033641.BGIv1.0 annot-version=v1.0
MEASANSFTYATLIDCLCKGGKLDDALSLLEEMKRKSLNVDVVVYGSLINGFVSRGRYDDGKKIFDEMMQKGVMPNVVVYSYLMNGLCKMKQWNVVMNML
TAMSEMGVDPDVVTYTYLIKGLCKDGKSSKAVELFRRIQDRDEDVECCTL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G28010 Tetratricopeptide repeat (TPR)... Lus10033641 0 1
AT4G28010 Tetratricopeptide repeat (TPR)... Lus10033640 4.2 0.7764
AT3G20280 RING/FYVE/PHD zinc finger supe... Lus10013301 6.5 0.7996
AT3G22430 unknown protein Lus10041204 7.7 0.7789
AT5G11030 ALF4 aberrant lateral root formatio... Lus10006197 14.1 0.7871
AT1G68552 CPuORF53 conserved peptide upstream ope... Lus10041455 15.9 0.7461
AT1G49600 ATRBP47A RNA-binding protein 47A (.1) Lus10012071 26.3 0.7660
AT4G01100 ADNT1 adenine nucleotide transporter... Lus10032364 42.6 0.6774
Lus10010599 47.8 0.6746
AT1G77360 Tetratricopeptide repeat (TPR)... Lus10003703 56.1 0.6712
AT3G22430 unknown protein Lus10041205 60.2 0.7425

Lus10033641 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.