Lus10033647 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G51990 53 / 6e-09 O-methyltransferase family protein (.1.2)
AT4G35160 53 / 8e-09 O-methyltransferase family protein (.1)
AT4G35150 50 / 6e-08 O-methyltransferase family protein (.1)
AT1G62900 48 / 3e-07 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT1G63140 48 / 3e-07 O-methyltransferase family protein (.1.2)
AT1G76790 48 / 3e-07 IGMT5 indole glucosinolate O-methyltransferase 5, O-methyltransferase family protein (.1)
AT3G53140 46 / 1e-06 O-methyltransferase family protein (.1)
AT1G21130 46 / 2e-06 IGMT4 indole glucosinolate O-methyltransferase 4, O-methyltransferase family protein (.1.2)
AT5G53810 45 / 4e-06 O-methyltransferase family protein (.1)
AT1G21100 44 / 9e-06 IGMT1 indole glucosinolate O-methyltransferase 1, O-methyltransferase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017691 197 / 3e-63 AT4G35160 194 / 2e-58 O-methyltransferase family protein (.1)
Lus10018628 136 / 2e-39 AT4G35160 192 / 7e-58 O-methyltransferase family protein (.1)
Lus10018629 132 / 3e-38 AT4G35160 214 / 3e-66 O-methyltransferase family protein (.1)
Lus10033656 129 / 1e-36 AT4G35150 211 / 8e-65 O-methyltransferase family protein (.1)
Lus10001510 126 / 8e-36 AT4G35160 197 / 1e-59 O-methyltransferase family protein (.1)
Lus10017699 119 / 6e-33 AT4G35150 204 / 2e-62 O-methyltransferase family protein (.1)
Lus10008538 117 / 2e-32 AT4G35160 167 / 5e-48 O-methyltransferase family protein (.1)
Lus10017695 108 / 3e-30 AT4G35150 140 / 6e-40 O-methyltransferase family protein (.1)
Lus10033655 107 / 1e-28 AT4G35150 193 / 3e-58 O-methyltransferase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G121800 131 / 2e-38 AT4G35160 158 / 7e-46 O-methyltransferase family protein (.1)
Potri.019G093100 132 / 4e-38 AT4G35160 225 / 1e-70 O-methyltransferase family protein (.1)
Potri.013G121300 131 / 6e-38 AT4G35160 201 / 4e-61 O-methyltransferase family protein (.1)
Potri.013G122400 131 / 6e-38 AT4G35160 188 / 2e-56 O-methyltransferase family protein (.1)
Potri.013G120800 131 / 1e-37 AT4G35160 205 / 7e-63 O-methyltransferase family protein (.1)
Potri.013G121900 128 / 1e-36 AT4G35160 184 / 5e-55 O-methyltransferase family protein (.1)
Potri.013G121400 127 / 3e-36 AT4G35160 202 / 8e-62 O-methyltransferase family protein (.1)
Potri.019G093000 124 / 6e-35 AT4G35160 230 / 1e-72 O-methyltransferase family protein (.1)
Potri.013G122000 117 / 3e-32 AT4G35160 174 / 6e-51 O-methyltransferase family protein (.1)
Potri.004G050500 115 / 7e-32 AT4G35160 178 / 2e-52 O-methyltransferase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF00891 Methyltransf_2 O-methyltransferase domain
Representative CDS sequence
>Lus10033647 pacid=23143476 polypeptide=Lus10033647 locus=Lus10033647.g ID=Lus10033647.BGIv1.0 annot-version=v1.0
ATGGCGAACGCCATCGCAGTGGCGTTCCCCCCCGTCGGTTGCATGGTGCTCGATCTGCCCCATGTCGTCGCCGGTTTGGAAGACAATGGGAACGTGAAGT
ATATAGCCGGCGACGTGTTTCAGGCAATTCCTCCGGCCGACGCCATTTTGCTCAAGCTTGAAAATATTGAAGAAGTGCAAAGAAGCATTGTCGAGAGGAC
GAACAAGGGTAAAACAGGGAAAATGATTATCATAGATATGGTGGTGGATGATGAAAGATACTGTCTCGACAGCAGGATGCTGGTAGCTCAAAAGGGCCAG
GAGAGGAATAAAGGGGAATGGGTGAAGCTATTTGCCGATGCTGGATTCACCGGATACTACATCAACCCGATTCTTAGGACGAGAGCTCTTATCGAGGTCT
ATCCTTAG
AA sequence
>Lus10033647 pacid=23143476 polypeptide=Lus10033647 locus=Lus10033647.g ID=Lus10033647.BGIv1.0 annot-version=v1.0
MANAIAVAFPPVGCMVLDLPHVVAGLEDNGNVKYIAGDVFQAIPPADAILLKLENIEEVQRSIVERTNKGKTGKMIIIDMVVDDERYCLDSRMLVAQKGQ
ERNKGEWVKLFADAGFTGYYINPILRTRALIEVYP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G51990 O-methyltransferase family pro... Lus10033647 0 1
AT4G23160 CRK8 cysteine-rich RLK (RECEPTOR-li... Lus10024900 1.7 0.9061
AT5G14870 ATCNGC18 cyclic nucleotide-gated channe... Lus10039415 1.7 0.9276
Lus10040545 2.2 0.8954
AT1G10385 Vps51/Vps67 family (components... Lus10033648 2.4 0.9150
AT2G26850 F-box family protein (.1) Lus10036444 2.8 0.8156
Lus10019815 3.5 0.8839
AT1G08315 ARM repeat superfamily protein... Lus10006007 4.0 0.8976
AT3G16650 Transducin/WD40 repeat-like su... Lus10001473 4.2 0.8096
AT3G05725 Protein of unknown function (D... Lus10031405 4.5 0.7954
AT5G01300 PEBP (phosphatidylethanolamine... Lus10003388 4.6 0.8204

Lus10033647 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.