Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28480 86 / 3e-23 roxy19, GRX480 Thioredoxin superfamily protein (.1) AT5G14070 64 / 2e-14 ROXY2 Thioredoxin superfamily protein (.1) AT4G15690 59 / 8e-13 Thioredoxin superfamily protein (.1) AT1G03850 59 / 1e-12 ATGRXS13 glutaredoxin 13, Glutaredoxin family protein (.1.2) AT4G15670 58 / 2e-12 Thioredoxin superfamily protein (.1) AT4G15700 57 / 3e-12 Thioredoxin superfamily protein (.1) AT4G33040 57 / 9e-12 Thioredoxin superfamily protein (.1) AT4G15680 56 / 1e-11 Thioredoxin superfamily protein (.1) AT3G02000 56 / 2e-11 ROXY1 Thioredoxin superfamily protein (.1) AT4G15660 55 / 2e-11 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017693 [exp] 123 / 2e-38 AT1G28480 100 / 4e-29 Thioredoxin superfamily protein (.1) Lus10039867 [exp] 109 / 3e-32 AT1G28480 127 / 7e-39 Thioredoxin superfamily protein (.1) Lus10018631 [exp] 103 / 5e-30 AT1G28480 127 / 8e-39 Thioredoxin superfamily protein (.1) Lus10013962 [exp] 84 / 2e-22 AT1G28480 135 / 3e-42 Thioredoxin superfamily protein (.1) Lus10041538 [exp] 71 / 4e-17 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1) Lus10035183 [exp] 69 / 2e-16 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1) Lus10011333 [exp] 64 / 2e-14 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1) Lus10038514 [exp] 60 / 8e-13 AT5G14070 122 / 2e-36 Thioredoxin superfamily protein (.1) Lus10023295 [exp] 58 / 3e-12 AT5G14070 123 / 5e-37 Thioredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G049800 [exp] 84 / 2e-22 AT1G28480 94 / 2e-25 Thioredoxin superfamily protein (.1) Potri.007G134800 [exp] 81 / 5e-21 AT1G28480 141 / 9e-44 Thioredoxin superfamily protein (.1) Potri.017G017300 [exp] 80 / 1e-20 AT1G28480 132 / 3e-40 Thioredoxin superfamily protein (.1) Potri.011G058800 [exp] 74 / 2e-18 AT1G28480 102 / 2e-28 Thioredoxin superfamily protein (.1) Potri.001G060600 [exp] 71 / 2e-17 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1) Potri.001G325800 [exp] 71 / 3e-17 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1) Potri.003G167000 [exp] 69 / 2e-16 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1) Potri.014G133900 [exp] 54 / 1e-10 AT3G62930 141 / 4e-45 Thioredoxin superfamily protein (.1) Potri.010G021800 [exp] 53 / 2e-10 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.002G209300 [exp] 53 / 2e-10 AT1G03020 143 / 7e-46 Thioredoxin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033649 pacid=23143320 polypeptide=Lus10033649 locus=Lus10033649.g ID=Lus10033649.BGIv1.0 annot-version=v1.0 ATGACCCACGTCATCAAGCGGCTGCTCCTCTGTTTGGGAGTCAACCCGCCGGTTTTCGAGGTCGACGGAGGAGACGACGAGGGCAAGGTTTTGAAGGAGC TGCAGGCGACGGCGGAGAAAGATACGGCGGTGGTGGTGCAGTTGCCGGCGGTTTTCATTGGTGGGAAGTTGTTGGGTGGGTTAGATAAGGTTGTGGCCAC TCATATAACCGGTGAATTGGTTCCGATTCTCAAACAAGCTGGAGCCTTGTGGCTATGA
AA sequence Show only first row Show all	>Lus10033649 pacid=23143320 polypeptide=Lus10033649 locus=Lus10033649.g ID=Lus10033649.BGIv1.0 annot-version=v1.0 MTHVIKRLLLCLGVNPPVFEVDGGDDEGKVLKELQATAEKDTAVVVQLPAVFIGGKLLGGLDKVVATHITGELVPILKQAGALWL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G28480		roxy19, GRX480	Thioredoxin superfamily protei...		Lus10033649 [exp]	0	1
AT5G46760	bHLH	bHLH005, ATR2, ...	Basic helix-loop-helix (bHLH) ...		Lus10035365 [exp]	6.5	0.7734
AT4G34950			Major facilitator superfamily ...		Lus10010805 [exp]	14.3	0.7248
AT3G50120			Plant protein of unknown funct...		Lus10019324 [exp]	16.6	0.7388
AT5G17820			Peroxidase superfamily protein...		Lus10005681 [exp]	18.3	0.7106
AT2G41010		ATCAMBP25	calmodulin (CAM)-binding prote...		Lus10016205 [exp]	18.7	0.7485
AT2G03380			Pentatricopeptide repeat (PPR)...		Lus10026641 [exp]	25.4	0.7288
					Lus10042018 [exp]	26.5	0.6456
AT3G46140			Protein kinase superfamily pro...		Lus10039141 [exp]	32.6	0.7154
					Lus10030316 [exp]	33.6	0.7062
AT1G05170			Galactosyltransferase family p...		Lus10001148 [exp]	34.8	0.7086

Compare expression of checked genes

Lus10033649 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.