Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03200 50 / 6e-08 NAC ANAC045 NAC domain containing protein 45 (.1) AT1G54330 50 / 7e-08 NAC ANAC020 NAC domain containing protein 20 (.1) AT5G17260 50 / 1e-07 NAC ANAC086 NAC domain containing protein 86 (.1) AT3G10490 49 / 1e-07 NAC ANAC051, ANAC052 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2) AT3G17730 49 / 1e-07 NAC ANAC057 NAC domain containing protein 57 (.1) AT1G71930 48 / 4e-07 NAC VND7, ANAC030 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1) AT3G10480 48 / 4e-07 NAC ANAC050 NAC domain containing protein 50 (.1.2.3) AT1G65910 47 / 7e-07 NAC ANAC028 NAC domain containing protein 28 (.1) AT1G12260 45 / 3e-06 NAC ANAC007, VND4, EMB2749 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1) AT5G53950 44 / 7e-06 NAC ATCUC2, CUC2, ANAC098 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033652 [exp] 286 / 2e-99 AT1G62700 54 / 2e-08 VASCULAR RELATED NAC-DOMAIN PROTEIN 5, Arabidopsis NAC domain containing protein 26 (.1) Lus10017697 [exp] 119 / 2e-33 AT2G24180 135 / 6e-36 cytochrome p450 71b6 (.1) Lus10014342 [exp] 111 / 1e-31 AT3G10490 51 / 5e-08 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2) Lus10035400 [exp] 92 / 1e-23 AT1G79580 61 / 1e-10 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Lus10019638 [exp] 87 / 2e-21 AT1G12260 59 / 4e-10 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1) Lus10022965 [exp] 62 / 7e-12 AT2G24430 62 / 1e-10 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Lus10033279 [exp] 59 / 1e-10 AT5G62380 61 / 5e-10 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) Lus10033676 [exp] 56 / 8e-10 AT3G10480 72 / 4e-13 NAC domain containing protein 50 (.1.2.3) Lus10008200 [exp] 53 / 6e-09 ND 43 / 6e-05
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G028700 [exp] 58 / 2e-10 AT2G24430 65 / 1e-11 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.001G220500 [exp] 57 / 2e-10 AT1G77450 66 / 4e-12 NAC domain containing protein 32 (.1) Potri.006G029200 [exp] 54 / 3e-09 AT3G10480 67 / 8e-13 NAC domain containing protein 50 (.1.2.3) Potri.019G063000 [exp] 52 / 8e-09 AT1G79580 56 / 4e-09 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.015G002900 [exp] 52 / 3e-08 AT1G71930 71 / 2e-13 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1) Potri.008G081500 [exp] 50 / 1e-07 AT1G54330 316 / 1e-107 NAC domain containing protein 20 (.1) Potri.006G028900 [exp] 50 / 1e-07 AT3G10480 71 / 8e-14 NAC domain containing protein 50 (.1.2.3) Potri.006G028300 [exp] 49 / 2e-07 AT3G10480 74 / 5e-14 NAC domain containing protein 50 (.1.2.3) Potri.006G051400 [exp] 47 / 7e-07 AT3G04070 121 / 1e-31 NAC domain containing protein 47 (.1.2) Potri.012G038100 [exp] 47 / 7e-07 AT3G17730 339 / 4e-118 NAC domain containing protein 57 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10033650 pacid=23143514 polypeptide=Lus10033650 locus=Lus10033650.g ID=Lus10033650.BGIv1.0 annot-version=v1.0 ATGGACGCCGATCAGATAATGGAGAACAGGAAGAACTTCTTCGCTTCCTTAAACCTCTCTTCCGCAATCCGGTTCCGTCCCACCGAGAAGCAACTAGTAG GCCAGTTTCTCCTTCGCAAGATCCGAGGAACGTGCGATCCGGATGACCCCATAGTGGAGGCCGACTTGTACGCTACCGAGCCGTGGCTTCTCTGGGAAGC TTACTCGTCGTCTCGAGAACAATCTCATGGTGCTGACGTGGATGACAGGGATGAGATTCTTTACTTCTACACCAAGCTCAAGAGCAAGAAGCTCTCCAAC GGCGAGAGGAAGTCGTCCAGGATCGACCGAGCAGTGGCCGACGGGAAAGGCGGCACGTGGCATCAGGAGGCCGTTTCCAAGATCTACGTCCGCCATCATC TCGTAACCAAGAAGAAGAACAAACAAGGTACCTTTACGTAA
AA sequence Show only first row Show all	>Lus10033650 pacid=23143514 polypeptide=Lus10033650 locus=Lus10033650.g ID=Lus10033650.BGIv1.0 annot-version=v1.0 MDADQIMENRKNFFASLNLSSAIRFRPTEKQLVGQFLLRKIRGTCDPDDPIVEADLYATEPWLLWEAYSSSREQSHGADVDDRDEILYFYTKLKSKKLSN GERKSSRIDRAVADGKGGTWHQEAVSKIYVRHHLVTKKKNKQGTFT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G03200	NAC	ANAC045	NAC domain containing protein ...		Lus10033650 [exp]	0	1
AT5G20950			Glycosyl hydrolase family prot...		Lus10043457 [exp]	7.1	0.9668
AT5G11420			Protein of unknown function, D...		Lus10025753 [exp]	10.7	0.9619
AT2G04220			Plant protein of unknown funct...		Lus10043317 [exp]	12.8	0.9706
AT3G61640		AGP20, ATAGP20	arabinogalactan protein 20 (.1...		Lus10032355 [exp]	18.4	0.9679
					Lus10030380 [exp]	20.4	0.9135
AT4G35783		RTFL6, DVL17	DEVIL 17, ROTUNDIFOLIA like 6 ...		Lus10028393 [exp]	26.2	0.9652
AT3G28050			nodulin MtN21 /EamA-like trans...		Lus10030842 [exp]	32.7	0.9617
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10032263 [exp]	35.3	0.9609
AT2G42560			late embryogenesis abundant do...		Lus10000465 [exp]	37.3	0.9018
AT3G21720		ICL	isocitrate lyase (.1)		Lus10031552 [exp]	37.7	0.9605

Compare expression of checked genes

Lus10033650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.