Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24060 72 / 2e-17 Plant self-incompatibility protein S1 family (.1) AT1G55520 55 / 4e-10 ATTBP2, TBP2 A. THALIANA TATA BINDING PROTEIN 2, TATA binding protein 2 (.1.2) AT3G13445 52 / 3e-09 TFIID-1, TBP1 TRANSCRIPTION FACTOR IID-1, TATA binding protein 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017719 [exp] 118 / 2e-35 AT3G24060 157 / 4e-50 Plant self-incompatibility protein S1 family (.1) Lus10023675 [exp] 92 / 6e-25 AT3G24060 162 / 3e-52 Plant self-incompatibility protein S1 family (.1) Lus10011754 [exp] 90 / 2e-24 AT3G24060 152 / 1e-48 Plant self-incompatibility protein S1 family (.1) Lus10017716 [exp] 84 / 3e-21 AT1G55520 125 / 1e-36 A. THALIANA TATA BINDING PROTEIN 2, TATA binding protein 2 (.1.2) Lus10020260 [exp] 56 / 1e-10 AT1G55520 380 / 3e-136 A. THALIANA TATA BINDING PROTEIN 2, TATA binding protein 2 (.1.2) Lus10002634 [exp] 56 / 2e-10 AT1G55520 382 / 7e-137 A. THALIANA TATA BINDING PROTEIN 2, TATA binding protein 2 (.1.2) Lus10031531 [exp] 52 / 4e-09 AT3G13445 333 / 4e-118 TRANSCRIPTION FACTOR IID-1, TATA binding protein 1 (.1.2) Lus10015150 [exp] 47 / 4e-08 AT1G55520 100 / 3e-28 A. THALIANA TATA BINDING PROTEIN 2, TATA binding protein 2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G053100 [exp] 83 / 1e-21 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 82 / 5e-21 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1) Potri.013G059300 [exp] 53 / 1e-09 AT1G55520 380 / 9e-137 A. THALIANA TATA BINDING PROTEIN 2, TATA binding protein 2 (.1.2) Potri.019G033300 [exp] 53 / 2e-09 AT1G55520 376 / 4e-135 A. THALIANA TATA BINDING PROTEIN 2, TATA binding protein 2 (.1.2) Potri.001G053300 [exp] 45 / 1e-06 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10033675 pacid=23143452 polypeptide=Lus10033675 locus=Lus10033675.g ID=Lus10033675.BGIv1.0 annot-version=v1.0 ATGAGGACCAGGTTCTGGGACAGCAGCAGCGTCAGGATCCTGTGTACGATGAAGTGGGATGGGAAGAGGAGGAAGTTCGAGGCGTTTAAGGTTCCAAGGG ATTTGCGGATGTTCAATCCGACGAGGAAGTGCTCTTGGTTGGTTAGGGAGGATGGGTTCTACTTCAGCAGCGATGAGGCTAAGAGCGAGGCGGATTCCAA ATTGGCAGCCAGAAAGTTTACTAGGACCATCCAGAAGCTTGGCTTTCCTGCAAGATTCGAGGACTTCACAATCCGTAACAAGGAGTTCAGGATCGAAAAC ATCGTAGTTCGACGAGCCAACCCGTGGACTGGAAGGAGGCTCGGCTAA
AA sequence Show only first row Show all	>Lus10033675 pacid=23143452 polypeptide=Lus10033675 locus=Lus10033675.g ID=Lus10033675.BGIv1.0 annot-version=v1.0 MRTRFWDSSSVRILCTMKWDGKRRKFEAFKVPRDLRMFNPTRKCSWLVREDGFYFSSDEAKSEADSKLAARKFTRTIQKLGFPARFEDFTIRNKEFRIEN IVVRRANPWTGRRLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G24060			Plant self-incompatibility pro...		Lus10033675 [exp]	0	1
					Lus10011286 [exp]	15.4	0.5449
AT1G20960		EMB1507	embryo defective 1507, U5 smal...		Lus10042629 [exp]	25.9	0.5165
AT3G04310			unknown protein		Lus10032791 [exp]	40.9	0.5160
AT5G11090			serine-rich protein-related (....		Lus10038101 [exp]	99.0	0.4823

Compare expression of checked genes

Lus10033675 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.