Lus10033677 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10033677 pacid=23143333 polypeptide=Lus10033677 locus=Lus10033677.g ID=Lus10033677.BGIv1.0 annot-version=v1.0
ATGGATTTCTTTGGAATCAGCTCTGATTCCACAGACATTCACATTCCAGATTATGCCCCTCTTTCCTGGTTCCTTACCTATGAAGCATCGGATTCTTTCC
TCGTCGTTCTTCCTGTTGACATTGTTGCAGAAGGAATAGGTACTTGGAAGAATGAGTGCAGACAGGGAGAGCTGTCGCAGCACAAAATTCTCGTGGTCGA
GGTTTTCGAGGGAGACACAGGTGGGACATGGCACTGGCGGAACTGGGGTGGATCACCGTCGAGAGTCTCCTGTTCCGAGATTAGTGAAACTCTTATGTTA
AACATTGGTCTTGGTTTTAAGGATGTACCCTATGCGAGGACACCGTTTGAAGGACGAGTAGATGAAATCGGGAGCCGGAACCACCAGACCGCCAGTAGCA
ATGACACCGTTTACAATCACAAACTAGCTAGAGGATCGACGACATAG
AA sequence
>Lus10033677 pacid=23143333 polypeptide=Lus10033677 locus=Lus10033677.g ID=Lus10033677.BGIv1.0 annot-version=v1.0
MDFFGISSDSTDIHIPDYAPLSWFLTYEASDSFLVVLPVDIVAEGIGTWKNECRQGELSQHKILVVEVFEGDTGGTWHWRNWGGSPSRVSCSEISETLML
NIGLGFKDVPYARTPFEGRVDEIGSRNHQTASSNDTVYNHKLARGSTT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10033677 0 1
AT5G38200 Class I glutamine amidotransfe... Lus10016700 4.4 0.8785
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Lus10008614 9.5 0.8625
AT2G24610 ATCNGC14 cyclic nucleotide-gated channe... Lus10020122 10.6 0.8584
AT4G37390 AUR3, YDK1, GH3... YADOKARI 1, AUXIN UPREGULATED ... Lus10014869 20.9 0.8483
AT2G29070 Ubiquitin fusion degradation U... Lus10029298 23.4 0.8621
AT4G00910 Aluminium activated malate tra... Lus10033223 26.5 0.8252
Lus10030774 27.2 0.8536
Lus10015147 28.0 0.8171
AT3G45140 ATLOX2, LOX2 ARABIODOPSIS THALIANA LIPOXYGE... Lus10041646 29.1 0.8265
AT2G04520 Nucleic acid-binding, OB-fold-... Lus10020713 31.6 0.8337

Lus10033677 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.