Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28290 49 / 3e-09 unknown protein AT5G42110 45 / 4e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031644 [exp] 74 / 4e-19 AT4G28290 59 / 2e-13 unknown protein Lus10018592 [exp] 58 / 8e-13 AT4G28290 52 / 1e-10 unknown protein Lus10039825 [exp] 57 / 2e-12 AT4G28290 51 / 2e-10 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G111501 [exp] 51 / 3e-10 AT4G28290 49 / 3e-09 unknown protein Potri.019G100601 [exp] 51 / 3e-10 AT4G28290 49 / 3e-09 unknown protein Potri.001G449633 [exp] 48 / 5e-09 AT4G28290 45 / 7e-08 unknown protein Potri.013G131900 [exp] 46 / 3e-08 AT4G28290 47 / 7e-09 unknown protein Potri.011G151900 [exp] 41 / 3e-06 AT5G42110 38 / 3e-05 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033693 pacid=23143296 polypeptide=Lus10033693 locus=Lus10033693.g ID=Lus10033693.BGIv1.0 annot-version=v1.0 ATGAAGAAATCCGGCCTTCTCGCTGCCTCCTCCGCCGTCGCCGCCGCCGCTTCTGCAACCGCCATCTCTACTCCTCCTCCTCCTTCCTCTTCTCGTCAGG AGGGTGGTTCTGACAATGATCAGCGACAGAACAGGAAGCCTTCGGCAGCGGCGGCGGCGGCGGGGGACAAGTTTGCTCCGAGATTCGACGGATTGAGGTT TATCGAGACGTTGGTGACTGCTCATCGGTAG
AA sequence Show only first row Show all	>Lus10033693 pacid=23143296 polypeptide=Lus10033693 locus=Lus10033693.g ID=Lus10033693.BGIv1.0 annot-version=v1.0 MKKSGLLAASSAVAAAASATAISTPPPPSSSRQEGGSDNDQRQNRKPSAAAAAAGDKFAPRFDGLRFIETLVTAHR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28290			unknown protein		Lus10033693 [exp]	0	1
					Lus10031606 [exp]	1.7	0.8858
AT3G22970			Protein of unknown function (D...		Lus10003087 [exp]	5.5	0.8520
AT1G19640		JMT	jasmonic acid carboxyl methylt...		Lus10025993 [exp]	7.2	0.7453
AT2G21180			unknown protein		Lus10007573 [exp]	13.7	0.8564
					Lus10020547 [exp]	14.0	0.8112
AT5G50160		ATFRO8, FRO8	ferric reduction oxidase 8 (.1...		Lus10019488 [exp]	15.0	0.8359
AT2G17840		ERD7	EARLY-RESPONSIVE TO DEHYDRATIO...		Lus10034499 [exp]	20.0	0.8120
AT3G03440			ARM repeat superfamily protein...		Lus10033593 [exp]	24.0	0.7898
AT2G46690			SAUR-like auxin-responsive pro...		Lus10010110 [exp]	28.1	0.8423
AT3G60160		ATMRP9, ABCC9	ATP-binding cassette C9, multi...		Lus10011875 [exp]	28.3	0.7819

Compare expression of checked genes

Lus10033693 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.