Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20820 99 / 2e-28 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031625 [exp] 154 / 4e-50 AT2G20820 102 / 1e-29 unknown protein Lus10037883 [exp] 99 / 7e-28 AT2G20820 83 / 8e-22 unknown protein Lus10038583 [exp] 88 / 1e-23 AT2G20820 75 / 1e-18 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G109100 [exp] 114 / 1e-34 AT2G20820 97 / 9e-28 unknown protein Potri.013G146000 [exp] 105 / 3e-31 AT2G20820 76 / 3e-19 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033715 pacid=23143482 polypeptide=Lus10033715 locus=Lus10033715.g ID=Lus10033715.BGIv1.0 annot-version=v1.0 ATGGCGATGGCTACACTCGCTGCAGCTCGTCGAGTCGCCGCACTCGGCCGATACTCATCGCCCAACGTATCCGCCGCCTCCTCTCTTATCCCCCGCCGCG GCCTCGCCGGCGCTGCAGATCACCATGGGACTCCTAAGGTTAACTGTTGGTCGAAGCCAACGGATCCAGCTAACTGGAAGGAAGAACACTTCGTAATCGT CTCTCTAACTGGTTGGGGTCTCCTCATCTACGGGAGCTACAAGTTCTTCACCGGAGGGAAGAAGGAAGAGGTAACTTTACACTCTCCTTTGATCTGA
AA sequence Show only first row Show all	>Lus10033715 pacid=23143482 polypeptide=Lus10033715 locus=Lus10033715.g ID=Lus10033715.BGIv1.0 annot-version=v1.0 MAMATLAAARRVAALGRYSSPNVSAASSLIPRRGLAGAADHHGTPKVNCWSKPTDPANWKEEHFVIVSLTGWGLLIYGSYKFFTGGKKEEVTLHSPLI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20820			unknown protein		Lus10033715 [exp]	0	1
AT1G12500			Nucleotide-sugar transporter f...		Lus10007029 [exp]	1.4	0.8989
AT4G11090		TBL23	TRICHOME BIREFRINGENCE-LIKE 23...		Lus10032367 [exp]	2.8	0.8805
AT5G52540			Protein of unknown function (D...		Lus10039273 [exp]	5.5	0.8759
AT4G32390			Nucleotide-sugar transporter f...		Lus10002904 [exp]	6.0	0.8917
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Lus10041288 [exp]	7.7	0.8639
AT1G05850		CTL1, HOT2, ERH...	POM-POM1, SENSITIVE TO HOT TEM...		Lus10037430 [exp]	8.4	0.8738
AT3G07950			rhomboid protein-related (.1)		Lus10036521 [exp]	9.5	0.8857
AT2G18910			hydroxyproline-rich glycoprote...		Lus10006958 [exp]	9.8	0.8393
AT1G69430			unknown protein		Lus10036796 [exp]	11.2	0.8685
AT4G00110		GAE3	UDP-D-glucuronate 4-epimerase ...		Lus10030281 [exp]	11.8	0.8797

Compare expression of checked genes

Lus10033715 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.