Lus10033727 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033726 49 / 1e-07 ND 46 / 2e-06
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10033727 pacid=23143376 polypeptide=Lus10033727 locus=Lus10033727.g ID=Lus10033727.BGIv1.0 annot-version=v1.0
ATGATCATCAATCAGGAAGTAGTTGATGCCGAGAGTAACACCATAGTTGAACAGTTTGGTCGGATGATGGAGTTGGGTAAGGTTCCAGAGAATCTCCGTT
CAAGAGCATGGCGCTTTCGAATTTGCACAGCCGTGTACCGGAGTCTCTCCGCCAGAGATCGTGGCGCCAATGGCAGTGGCCATCTCCAAATCCTGCAACA
ACTGCCGAAGCCAATCTTAACCACTTTGATAGGCGTCACTGAAGTTGTACCTATGTATGTAAGCCATTTCGATTCAGATCTAGCCGTTTGCATTAAGATA
TTCCATAAACCCATCGATCTAGCTGGTAACTCCATGGAAAACATTCCGATTGATTCTGTTGAGATCGGCATTCGATTCGGAGTTTTATCTGCGATTCATG
CCCTCAAACTCCACAATCAGAACTTCCAATCGTATCTGATTCACAATCGTTGGGTGAATGGGTCTGATCGGAACTGGAAAATTCTGATGAGGACACTAAG
AAAACCCAATTAG
AA sequence
>Lus10033727 pacid=23143376 polypeptide=Lus10033727 locus=Lus10033727.g ID=Lus10033727.BGIv1.0 annot-version=v1.0
MIINQEVVDAESNTIVEQFGRMMELGKVPENLRSRAWRFRICTAVYRSLSARDRGANGSGHLQILQQLPKPILTTLIGVTEVVPMYVSHFDSDLAVCIKI
FHKPIDLAGNSMENIPIDSVEIGIRFGVLSAIHALKLHNQNFQSYLIHNRWVNGSDRNWKILMRTLRKPN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10033727 0 1
AT3G63110 ATIPT3 isopentenyltransferase 3 (.1) Lus10028015 3.2 0.9043
AT1G48590 Calcium-dependent lipid-bindin... Lus10003710 5.2 0.8997
AT4G32870 Polyketide cyclase/dehydrase a... Lus10000573 6.5 0.9003
AT3G05170 Phosphoglycerate mutase family... Lus10032291 7.5 0.8916
Lus10041616 7.7 0.8972
AT1G61600 Protein of unknown function (D... Lus10035379 9.5 0.8890
AT1G49330 hydroxyproline-rich glycoprote... Lus10015036 9.6 0.8419
Lus10025141 11.8 0.8982
AT3G12350 F-box family protein (.1.2) Lus10010607 14.9 0.8054
AT5G22580 Stress responsive A/B Barrel D... Lus10020555 18.5 0.8892

Lus10033727 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.