Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28240 54 / 2e-11 Wound-responsive family protein (.1) AT4G10265 43 / 4e-07 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031617 [exp] 143 / 2e-46 AT4G28240 72 / 4e-18 Wound-responsive family protein (.1) Lus10039758 [exp] 99 / 4e-29 AT4G28240 59 / 5e-13 Wound-responsive family protein (.1) Lus10018535 [exp] 96 / 1e-27 AT4G28240 69 / 9e-17 Wound-responsive family protein (.1) Lus10027667 [exp] 94 / 4e-27 ND / Lus10039755 [exp] 47 / 2e-08 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10018533 [exp] 44 / 3e-07 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10018530 [exp] 44 / 5e-07 AT4G10270 119 / 8e-37 Wound-responsive family protein (.1) Lus10039760 [exp] 42 / 1e-06 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10039751 [exp] 42 / 3e-06 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G147700 [exp] 86 / 9e-24 AT4G28240 63 / 1e-14 Wound-responsive family protein (.1) Potri.019G116300 [exp] 75 / 3e-19 AT4G28240 / Wound-responsive family protein (.1) Potri.019G116932 [exp] 54 / 4e-11 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117100 [exp] 54 / 4e-11 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117402 [exp] 52 / 3e-10 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117500 [exp] 52 / 3e-10 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117632 [exp] 51 / 6e-10 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G116600 [exp] 50 / 1e-09 AT4G10270 82 / 4e-22 Wound-responsive family protein (.1) Potri.019G116866 [exp] 49 / 2e-09 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1) Potri.019G117201 [exp] 48 / 6e-09 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10033728 pacid=23143474 polypeptide=Lus10033728 locus=Lus10033728.g ID=Lus10033728.BGIv1.0 annot-version=v1.0 ATGGCGGCCACCGTCGCAGTAGTACAAGGCCCTCACCCGGACCAGGGCGGTAGCAAATGGAGATCCAGCCTCCAGTCTCTCCACCACGAGAAGCGGCGGC TCTTCTCCTGCTCCGGCGACGCCTCTGATCTACGACCCCTTGCCGGAGCTTCCACGATCGGGTCCGATCGGGTGGACGACGGAGTGAGGCACAGTGACGA GTCGCTCCGGCGAGTCATGTACCTCAATTGCTGGGGCTAG
AA sequence Show only first row Show all	>Lus10033728 pacid=23143474 polypeptide=Lus10033728 locus=Lus10033728.g ID=Lus10033728.BGIv1.0 annot-version=v1.0 MAATVAVVQGPHPDQGGSKWRSSLQSLHHEKRRLFSCSGDASDLRPLAGASTIGSDRVDDGVRHSDESLRRVMYLNCWG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28240			Wound-responsive family protei...		Lus10033728 [exp]	0	1
AT5G65660			hydroxyproline-rich glycoprote...		Lus10032818 [exp]	3.5	0.8276
AT4G36040		J11	DnaJ11, Chaperone DnaJ-domain ...		Lus10041906 [exp]	4.2	0.8631
AT3G07870			F-box and associated interacti...		Lus10006403 [exp]	4.5	0.8616
					Lus10039608 [exp]	5.8	0.7904
AT4G19670			RING/U-box superfamily protein...		Lus10038341 [exp]	12.6	0.8143
AT3G09880		ATB' BETA, ATB'...	Protein phosphatase 2A regulat...		Lus10021511 [exp]	13.2	0.8115
AT4G17250			unknown protein		Lus10000731 [exp]	14.8	0.7839
					Lus10007992 [exp]	15.3	0.7952
AT2G34140	DOF	AtDof2. 3	Dof-type zinc finger DNA-bindi...		Lus10013905 [exp]	18.8	0.7917
AT3G18140			Transducin/WD40 repeat-like su...		Lus10042333 [exp]	20.8	0.8076

Compare expression of checked genes

Lus10033728 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.